Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor-associated calcium signal transducer 2 (TACSTD2), partial , Active Protein

Recombinant Human Tumor-associated calcium signal transducer 2 (TACSTD2), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Tumor-associated calcium signal transducer 2 (TACSTD2) . Accession Number: P09758; TACSTD2. Expression Region: 27-274aa. Tag Info: C-terminal 10xHis-tagged. Theoretical MW: 30.6kda. Target Synonyms: Cell surface glycoprotein Trop-2; Membrane component chromosome 1 surface marker 1; Pancreatic carcinoma marker protein GA733-1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Tumor-associated calcium signal transducer 2 (TACSTD2), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P09758; TACSTD2

Expression Region

27-274aa

Host

Mammalian Cells

Target

Tumor-associated calcium signal transducer 2 (TACSTD2)

Conjugation

Unconjugated

Tag

C-Terminal 10xHis-Tagged

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

30.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cell surface glycoprotein Trop-2; Membrane component chromosome 1 surface marker 1; Pancreatic carcinoma marker protein GA733-1

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr616 (NM_147099) Mouse Tagged Lenti ORF Clone
MR214889L3 10 µg

Olfr616 (NM_147099) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
HIGD1C (NM_001109619) Human Tagged Lenti ORF Clone
RC225015L3 10 µg

HIGD1C (NM_001109619) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RPL37AP1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1985908 1.0 µg DNA

RPL37AP1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Anti-SHMT2 Antibody
MBS8245755-01 0.03 mL

Anti-SHMT2 Antibody

Sign In for Pricing
View Details
Anti-SHMT2 Antibody
MBS8245755-02 0.05 mL

Anti-SHMT2 Antibody

Sign In for Pricing
View Details
Anti-SHMT2 Antibody
MBS8245755-03 0.1 mL

Anti-SHMT2 Antibody

Sign In for Pricing
View Details