Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis lymphocyte antigen 6 family member G6D (LY6G6D), Active Protein

Recombinant Macaca fascicularis lymphocyte antigen 6 family member G6D (LY6G6D), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) . Target Name: lymphocyte antigen 6 family member G6D (LY6G6D) . Accession Number: UJY53414.1; LY6G6D. Expression Region: 20-104aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 11.1kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Macaca fascicularis lymphocyte antigen 6 family member G6D (LY6G6D), Active Protein is a purified Active Recombinant Protein.

Accession Number

UJY53414.1; LY6G6D

Expression Region

20-104aa

Host

Yeast

Target

Lymphocyte antigen 6 family member G6D (LY6G6D)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

11.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Protein Name

Active Recombinant Protein

AA Sequence

NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAARHCNQVETESVGDVTYPAHRDCYLGDLCNS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CXCL9/MIG Alexa Fluor 647 Antibody (Clone 49106)
IC392R-100UG 100 µg

Human CXCL9/MIG Alexa Fluor 647 Antibody (Clone 49106)

Sign In for Pricing
View Details
VEGFA Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-63036R-BF405 100 µL

VEGFA Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
ZIC1 (NM_003412) Human Tagged ORF Clone Lentiviral Particle
RC211177L1V 200 µL

ZIC1 (NM_003412) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Olfr199 3'UTR GFP Stable Cell Line
TU165032 1.0 mL

Olfr199 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Fancf sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3095806 1.0 µg DNA

Fancf sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
PHF21A (BHC80, KIAA1696, PHD Finger Protein 21A, BHC80a, BRAF35-HDAC Complex Protein BHC80) (MaxLight 490)
MBS6202452-01 0.1 mL

PHF21A (BHC80, KIAA1696, PHD Finger Protein 21A, BHC80a, BRAF35-HDAC Complex Protein BHC80) (MaxLight 490)

Sign In for Pricing
View Details