Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor receptor superfamily member 10D (TNFRSF10D), partial

Recombinant Human Tumor necrosis factor receptor superfamily member 10D (TNFRSF10D), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Tumor necrosis factor receptor superfamily member 10D (TNFRSF10D) . Accession Number: Q9UBN6; TNFRSF10D. Expression Region: 56-211aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 18.3kda. Target Synonyms: Decoy receptor 2; DcR2; TNF-related apoptosis-inducing ligand receptor 4; TRAIL receptor 4; TRAIL-R4; TRAIL receptor with a truncated death domain; CD antigen CD264 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Tumor necrosis factor receptor superfamily member 10D (TNFRSF10D), partial is a purified Recombinant Protein.

Accession Number

Q9UBN6; TNFRSF10D

Expression Region

56-211aa

Host

Yeast

Target

Tumor necrosis factor receptor superfamily member 10D (TNFRSF10D)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

18.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Decoy receptor 2; DcR2; TNF-related apoptosis-inducing ligand receptor 4; TRAIL receptor 4; TRAIL-R4; TRAIL receptor with a truncated death domain; CD antigen CD264

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLASPYH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE-Linked Polyclonal Antibody to Neuro Oncological Ventral Antigen 1 (NOVA1)
MBS2067466-01 0.1 mL

PE-Linked Polyclonal Antibody to Neuro Oncological Ventral Antigen 1 (NOVA1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Neuro Oncological Ventral Antigen 1 (NOVA1)
MBS2067466-02 0.2 mL

PE-Linked Polyclonal Antibody to Neuro Oncological Ventral Antigen 1 (NOVA1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Neuro Oncological Ventral Antigen 1 (NOVA1)
MBS2067466-03 0.5 mL

PE-Linked Polyclonal Antibody to Neuro Oncological Ventral Antigen 1 (NOVA1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Neuro Oncological Ventral Antigen 1 (NOVA1)
MBS2067466-04 1 mL

PE-Linked Polyclonal Antibody to Neuro Oncological Ventral Antigen 1 (NOVA1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Neuro Oncological Ventral Antigen 1 (NOVA1)
MBS2067466-05 5 mL

PE-Linked Polyclonal Antibody to Neuro Oncological Ventral Antigen 1 (NOVA1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Neuro Oncological Ventral Antigen 1 (NOVA1)
MBS2067466-06 5x 5 mL

PE-Linked Polyclonal Antibody to Neuro Oncological Ventral Antigen 1 (NOVA1)

Sign In for Pricing
View Details