Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida albicans Glycerol-3-phosphate dehydrogenase [NAD (+) ] 2 (GPD2)

Recombinant Candida albicans Glycerol-3-phosphate dehydrogenase [NAD (+) ] 2 (GPD2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) . Target Name: Glycerol-3-phosphate dehydrogenase [NAD (+) ] 2 (GPD2) . Accession Number: Q59W33; GPD2. Expression Region: 1-371aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 42.3kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Candida albicans Glycerol-3-phosphate dehydrogenase [NAD (+) ] 2 (GPD2) is a purified Recombinant Protein.

Accession Number

Q59W33; GPD2

Expression Region

1-371aa

Host

Yeast

Target

Glycerol-3-phosphate dehydrogenase [NAD (+) ] 2 (GPD2)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

42.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Protein Name

Recombinant Protein

AA Sequence

MTTSPYPIETPFKVCIVGSGNWGTAVAKLVAENCAEKPNIFQRDVKMWVFEEEIEGRKLTEIINTEHENVKYLPEIKLPTNLVANPDIVDTVQDADLIVFNIPHQFLGRIVKQIEGKVKPTARAISCLKGLDVSPEGCKLLSTSITDTLKIYCGVLSGANIANEVAKGNWSETSIAYTVPEDFRGAGKDIDPFILKEAFHRPYFHVRVIEDVVGASIAGALKNVIACSVGFVEGAGWGDNAKAAIMRIGIKETIRFASYWELFKIKALSPPNPKTFTEESAGVADLITTCSGGRNVKVARYMIKNNVDAFEAEKIVLKGQSSQGILTAKEVHELLTNFNLQDEFPLLEATYKVIYENGSVDDFPQLLEGDQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC-Linked Polyclonal Antibody to Cluster Of Differentiation 72 (CD72)
MBS2053297-01 0.1 mL

APC-Linked Polyclonal Antibody to Cluster Of Differentiation 72 (CD72)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Cluster Of Differentiation 72 (CD72)
MBS2053297-02 0.2 mL

APC-Linked Polyclonal Antibody to Cluster Of Differentiation 72 (CD72)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Cluster Of Differentiation 72 (CD72)
MBS2053297-03 0.5 mL

APC-Linked Polyclonal Antibody to Cluster Of Differentiation 72 (CD72)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Cluster Of Differentiation 72 (CD72)
MBS2053297-04 1 mL

APC-Linked Polyclonal Antibody to Cluster Of Differentiation 72 (CD72)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Cluster Of Differentiation 72 (CD72)
MBS2053297-05 5 mL

APC-Linked Polyclonal Antibody to Cluster Of Differentiation 72 (CD72)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Cluster Of Differentiation 72 (CD72)
MBS2053297-06 5x 5 mL

APC-Linked Polyclonal Antibody to Cluster Of Differentiation 72 (CD72)

Sign In for Pricing
View Details