Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Trefoil factor 3 (TFF3)

Recombinant Dog Trefoil factor 3 (TFF3) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Dog (Canis familiaris; Canine) . Target Name: Trefoil factor 3 (TFF3) . Accession Number: Q863B4; TFF3. Expression Region: 24-80aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 13.9kda. Target Synonyms: Intestinal trefoil factor Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Dog Trefoil factor 3 (TFF3) is a purified Recombinant Protein.

Accession Number

Q863B4; TFF3

Expression Region

24-80aa

Host

E. coli

Target

Trefoil factor 3 (TFF3)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

13.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Intestinal trefoil factor

Species

Dog (Canis familiaris; Canine)

Protein Name

Recombinant Protein

AA Sequence

YQGLATNLCEVPPKDRVDCGYPEITSEQCVNRGCCFDSSIHGVPWCFKPLQDTECRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR70 Rabbit Polyclonal Antibody (Cy5)
orb870900 100 µL

GPR70 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
TFAP2B Protein Vector (Mouse) (pPM-C-HA)
46557025 500 ng

TFAP2B Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit angiotensinogen (aGT) ELISA Kit
YP-W101395-01 48 Tests

Rabbit angiotensinogen (aGT) ELISA Kit

Sign In for Pricing
View Details
Rabbit angiotensinogen (aGT) ELISA Kit
YP-W101395-02 96 Tests

Rabbit angiotensinogen (aGT) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Meis homeobox 3 Antibody (OTI3A7) [DyLight 680]
NBP2-72641FR 0.1 mL

Mouse Monoclonal Meis homeobox 3 Antibody (OTI3A7) [DyLight 680]

Sign In for Pricing
View Details
NCBP2 Antibody
orb682422 100 µL

NCBP2 Antibody

Sign In for Pricing
View Details