Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Transient receptor potential cation channel subfamily A member 1 (Trpa1), partial

Recombinant Rat Transient receptor potential cation channel subfamily A member 1 (Trpa1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Transient receptor potential cation channel subfamily A member 1 (Trpa1) . Accession Number: Q6RI86; Trpa1. Expression Region: 960-1125aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 27.3kda. Target Synonyms: Ankyrin-like with transmembrane domains protein 1; Wasabi receptor Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rat Transient receptor potential cation channel subfamily A member 1 (Trpa1), partial is a purified Recombinant Protein.

Accession Number

Q6RI86; Trpa1

Expression Region

960-1125aa

Host

E. coli

Target

Transient receptor potential cation channel subfamily A member 1 (Trpa1)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

27.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Ankyrin-like with transmembrane domains protein 1; Wasabi receptor

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

IGLAVGDIAEVQKHASLKRIAMQVELHTNLEKKLPFWYLRKVDQRSTIVYPNRPRHGRMLRFFHYFLSMQETRQEAPNIDTCLEMEILKQKYRLKDLTSLLEKQHELIKLIIQKMEIISETEDEDNHCSFQDRFKKERLEQMHSKWNFVLNAVKTKTHCSISHPDI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HPS1 Mouse Monoclonal Antibody [Clone ID: 5G12G2]
AM06210SU-N 100 µL

HPS1 Mouse Monoclonal Antibody [Clone ID: 5G12G2]

Sign In for Pricing
View Details
Gria2 (NM_001039195) Mouse Tagged Lenti ORF Clone
MR227068L3 10 µg

Gria2 (NM_001039195) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SLC25A47 Adenovirus (Rat)
44037056 1.0 mL

SLC25A47 Adenovirus (Rat)

Sign In for Pricing
View Details
Diphtheria Toxin (Corynebacterium diphtheriae Toxoid, DT) (MaxLight 550) discontinued
D8065-42C-ML550 100 µL

Diphtheria Toxin (Corynebacterium diphtheriae Toxoid, DT) (MaxLight 550) discontinued

Sign In for Pricing
View Details
FES (Proto-oncogene Tyrosine Protein Kinase Fes/Fps, Proto-oncogene FES, cFES, c-FES, Feline Sarcoma Oncogene, FPS, c-FPS) (FITC)
126752-FITC 100 µL

FES (Proto-oncogene Tyrosine Protein Kinase Fes/Fps, Proto-oncogene FES, cFES, c-FES, Feline Sarcoma Oncogene, FPS, c-FPS) (FITC)

Sign In for Pricing
View Details
MCM7 Antibody
C30131-01 50 μL

MCM7 Antibody

Sign In for Pricing
View Details