Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal)

Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Legionella pneumophila. Target Name: Peptidoglycan-associated lipoprotein (pal) . Accession Number: P26493; pal. Expression Region: 22-176aa. Tag Info: Tag-Free. Theoretical MW: 17.0kda. Target Synonyms: PAL; 19 kDa surface antigen; PPL Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal) is a purified Recombinant Protein.

Accession Number

P26493; pal

Expression Region

22-176aa

Host

E. coli

Target

Peptidoglycan-associated lipoprotein (pal)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

PAL; 19 kDa surface antigen; PPL

Species

Legionella pneumophila

Protein Name

Recombinant Protein

AA Sequence

CSKTPGSADGGAAVGDGDATAQGLGQMTHFAGQEPGESYTTQAPHNQLYLFAYDDSTLASKYLPSVNAQAEYLKTHPGARVMIAGHTDERGSREYNVALGERRADTVAEILRMAGVSRQQIRVVSYGKERPANYGHDEASHAQNRRVEFIYEATR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smoothelin Mouse Monoclonal Antibody
B2019905 1 mL

Smoothelin Mouse Monoclonal Antibody

Sign In for Pricing
View Details
LSM1 (U6 snRNA-Associated Sm-Like Protein LSm1, LSM1 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae) )
485126 100 µL

LSM1 (U6 snRNA-Associated Sm-Like Protein LSm1, LSM1 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae) )

Sign In for Pricing
View Details
Mageb1 sgRNA CRISPR Lentivector set (Mouse)
K3032001 3x 1.0 µg

Mageb1 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Mouse Olfactory receptor 12 (OLFR12) ELISA Kit
abx536805 96 Tests

Mouse Olfactory receptor 12 (OLFR12) ELISA Kit

Sign In for Pricing
View Details
Human Vesicular integral-membrane protein VIP36 ELISA Kit
MBS2884789-01 48 Well

Human Vesicular integral-membrane protein VIP36 ELISA Kit

Sign In for Pricing
View Details
Human Vesicular integral-membrane protein VIP36 ELISA Kit
MBS2884789-02 96 Well

Human Vesicular integral-membrane protein VIP36 ELISA Kit

Sign In for Pricing
View Details