Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal)

Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Legionella pneumophila. Target Name: Peptidoglycan-associated lipoprotein (pal) . Accession Number: P26493; pal. Expression Region: 22-176aa. Tag Info: Tag-Free. Theoretical MW: 17.0kda. Target Synonyms: PAL; 19 kDa surface antigen; PPL Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal) is a purified Recombinant Protein.

Accession Number

P26493; pal

Expression Region

22-176aa

Host

E. coli

Target

Peptidoglycan-associated lipoprotein (pal)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

PAL; 19 kDa surface antigen; PPL

Species

Legionella pneumophila

Protein Name

Recombinant Protein

AA Sequence

CSKTPGSADGGAAVGDGDATAQGLGQMTHFAGQEPGESYTTQAPHNQLYLFAYDDSTLASKYLPSVNAQAEYLKTHPGARVMIAGHTDERGSREYNVALGERRADTVAEILRMAGVSRQQIRVVSYGKERPANYGHDEASHAQNRRVEFIYEATR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATG7 Antibody
F46227-0.4ML 0.4 mL

ATG7 Antibody

Sign In for Pricing
View Details
Med15 (Mediator of RNA Polymerase II Transcription Subunit 15, Mediator Complex Subunit 15, Positive Cofactor 2 glutamine/Q-rich-Associated Protein, PC2 glutamine/Q-rich-Associated Protein, mPcqap, Med15, Pcqap)
302551 200 µL

Med15 (Mediator of RNA Polymerase II Transcription Subunit 15, Mediator Complex Subunit 15, Positive Cofactor 2 glutamine/Q-rich-Associated Protein, PC2 glutamine/Q-rich-Associated Protein, mPcqap, Med15, Pcqap)

Sign In for Pricing
View Details
GANAB Polyclonal Antibody, Biotin Conjugated
bs-6720R-Biotin 100 µL

GANAB Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Sorbic Acid (SA)
MBS2082371-01 0.1 mL

HRP-Linked Polyclonal Antibody to Sorbic Acid (SA)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Sorbic Acid (SA)
MBS2082371-02 0.2 mL

HRP-Linked Polyclonal Antibody to Sorbic Acid (SA)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Sorbic Acid (SA)
MBS2082371-03 0.5 mL

HRP-Linked Polyclonal Antibody to Sorbic Acid (SA)

Sign In for Pricing
View Details