Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal)

Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Legionella pneumophila. Target Name: Peptidoglycan-associated lipoprotein (pal) . Accession Number: P26493; pal. Expression Region: 22-176aa. Tag Info: Tag-Free. Theoretical MW: 17.0kda. Target Synonyms: PAL; 19 kDa surface antigen; PPL Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal) is a purified Recombinant Protein.

Accession Number

P26493; pal

Expression Region

22-176aa

Host

E. coli

Target

Peptidoglycan-associated lipoprotein (pal)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

PAL; 19 kDa surface antigen; PPL

Species

Legionella pneumophila

Protein Name

Recombinant Protein

AA Sequence

CSKTPGSADGGAAVGDGDATAQGLGQMTHFAGQEPGESYTTQAPHNQLYLFAYDDSTLASKYLPSVNAQAEYLKTHPGARVMIAGHTDERGSREYNVALGERRADTVAEILRMAGVSRQQIRVVSYGKERPANYGHDEASHAQNRRVEFIYEATR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

E-Vac with 4L PP Bottle and Lid
ARG1240 1 Each

E-Vac with 4L PP Bottle and Lid

Sign In for Pricing
View Details
P27 phospho-Ser10 Rabbit Polyclonal Antibody
E53P01605 100 µL

P27 phospho-Ser10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AP2S1 (Adaptor-related Protein Complex 2 sigma 1 Subunit, AP2 Complex Subunit sigma 1, AP-2 Complex Subunit sigma 1, AP 17, AP17, AP17 delta, Clathrin Assembly Protein 2 Small Chain, Clathrin-associated/assembly/adaptor Protein Small 2, CLAPS2, Clathrin Coat Assembly Protein AP17, Clathrin Coat-associated Protein AP17, HA2 17kD Subunit, Plasma Membrane Adaptor AP-2 17kD Protein) (Biotin)
123380-Biotin 100 µL

AP2S1 (Adaptor-related Protein Complex 2 sigma 1 Subunit, AP2 Complex Subunit sigma 1, AP-2 Complex Subunit sigma 1, AP 17, AP17, AP17 delta, Clathrin Assembly Protein 2 Small Chain, Clathrin-associated/assembly/adaptor Protein Small 2, CLAPS2, Clathrin Coat Assembly Protein AP17, Clathrin Coat-associated Protein AP17, HA2 17kD Subunit, Plasma Membrane Adaptor AP-2 17kD Protein) (Biotin)

Sign In for Pricing
View Details
Rabbit Polyclonal KMT2A/MLL Antibody [mFluor Violet 610 SE]
NB600-256MFV610 0.1 mL

Rabbit Polyclonal KMT2A/MLL Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
ADAMTS-8 (h) -PR
sc-43603-PR 10 µM - 20 µL

ADAMTS-8 (h) -PR

Sign In for Pricing
View Details
6-Phosphogluconolactonase (PGLS) Antibody
abx322120-01 20 µL

6-Phosphogluconolactonase (PGLS) Antibody

Sign In for Pricing
View Details