Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal)

Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Legionella pneumophila. Target Name: Peptidoglycan-associated lipoprotein (pal) . Accession Number: P26493; pal. Expression Region: 22-176aa. Tag Info: Tag-Free. Theoretical MW: 17.0kda. Target Synonyms: PAL; 19 kDa surface antigen; PPL Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal) is a purified Recombinant Protein.

Accession Number

P26493; pal

Expression Region

22-176aa

Host

E. coli

Target

Peptidoglycan-associated lipoprotein (pal)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

PAL; 19 kDa surface antigen; PPL

Species

Legionella pneumophila

Protein Name

Recombinant Protein

AA Sequence

CSKTPGSADGGAAVGDGDATAQGLGQMTHFAGQEPGESYTTQAPHNQLYLFAYDDSTLASKYLPSVNAQAEYLKTHPGARVMIAGHTDERGSREYNVALGERRADTVAEILRMAGVSRQQIRVVSYGKERPANYGHDEASHAQNRRVEFIYEATR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Complement factor I (CFI), partial
CSB-EP005279HU1-01 20 µg

Recombinant Human Complement factor I (CFI), partial

Sign In for Pricing
View Details
Recombinant Human Complement factor I (CFI), partial
CSB-EP005279HU1-02 100 µg

Recombinant Human Complement factor I (CFI), partial

Sign In for Pricing
View Details
Recombinant Human Complement factor I (CFI), partial
CSB-EP005279HU1-03 1 mg

Recombinant Human Complement factor I (CFI), partial

Sign In for Pricing
View Details
PIN, FLOATING, TUBE, Stainless Steel, Hydrophobic Coated, 300nL-Slot, 0.787mm Diameter, 17mm Exposed Length, 38.1mm Total Length
FP3NS300H 1 Each

PIN, FLOATING, TUBE, Stainless Steel, Hydrophobic Coated, 300nL-Slot, 0.787mm Diameter, 17mm Exposed Length, 38.1mm Total Length

Sign In for Pricing
View Details
Human Osteoadherin MAb (Clone 806001)
MAB2884 100 µg

Human Osteoadherin MAb (Clone 806001)

Sign In for Pricing
View Details
STING agonist-44
HY-176257 1 Each

STING agonist-44

Sign In for Pricing
View Details