Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal)

Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Legionella pneumophila. Target Name: Peptidoglycan-associated lipoprotein (pal) . Accession Number: P26493; pal. Expression Region: 22-176aa. Tag Info: Tag-Free. Theoretical MW: 17.0kda. Target Synonyms: PAL; 19 kDa surface antigen; PPL Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal) is a purified Recombinant Protein.

Accession Number

P26493; pal

Expression Region

22-176aa

Host

E. coli

Target

Peptidoglycan-associated lipoprotein (pal)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

PAL; 19 kDa surface antigen; PPL

Species

Legionella pneumophila

Protein Name

Recombinant Protein

AA Sequence

CSKTPGSADGGAAVGDGDATAQGLGQMTHFAGQEPGESYTTQAPHNQLYLFAYDDSTLASKYLPSVNAQAEYLKTHPGARVMIAGHTDERGSREYNVALGERRADTVAEILRMAGVSRQQIRVVSYGKERPANYGHDEASHAQNRRVEFIYEATR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rhesus monkey ANGPT2/Ang2 Protein, C-Fc
EWA42301 100 μg

Recombinant Rhesus monkey ANGPT2/Ang2 Protein, C-Fc

Sign In for Pricing
View Details
a1Acid Glycoprotein, CT (Alpha-1-acid Glycoprotein 1, AGP 1, Orosomucoid-1, OMD 1, AGP1, ORM1) (MaxLight 490)
MBS6461032-01 0.1 mL

a1Acid Glycoprotein, CT (Alpha-1-acid Glycoprotein 1, AGP 1, Orosomucoid-1, OMD 1, AGP1, ORM1) (MaxLight 490)

Sign In for Pricing
View Details
a1Acid Glycoprotein, CT (Alpha-1-acid Glycoprotein 1, AGP 1, Orosomucoid-1, OMD 1, AGP1, ORM1) (MaxLight 490)
MBS6461032-02 5x 0.1 mL

a1Acid Glycoprotein, CT (Alpha-1-acid Glycoprotein 1, AGP 1, Orosomucoid-1, OMD 1, AGP1, ORM1) (MaxLight 490)

Sign In for Pricing
View Details
N-Dodecyl-B-D-maltoside (DDM)
DDM5-50g 50 g

N-Dodecyl-B-D-maltoside (DDM)

Sign In for Pricing
View Details
SSX5 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-7013R-BF488 100 µL

SSX5 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
PFKFB3 Antibody - C-terminal region
MBS3212862-01 0.1 mL

PFKFB3 Antibody - C-terminal region

Sign In for Pricing
View Details