Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal)

Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Legionella pneumophila. Target Name: Peptidoglycan-associated lipoprotein (pal) . Accession Number: P26493; pal. Expression Region: 22-176aa. Tag Info: Tag-Free. Theoretical MW: 17.0kda. Target Synonyms: PAL; 19 kDa surface antigen; PPL Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal) is a purified Recombinant Protein.

Accession Number

P26493; pal

Expression Region

22-176aa

Host

E. coli

Target

Peptidoglycan-associated lipoprotein (pal)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

PAL; 19 kDa surface antigen; PPL

Species

Legionella pneumophila

Protein Name

Recombinant Protein

AA Sequence

CSKTPGSADGGAAVGDGDATAQGLGQMTHFAGQEPGESYTTQAPHNQLYLFAYDDSTLASKYLPSVNAQAEYLKTHPGARVMIAGHTDERGSREYNVALGERRADTVAEILRMAGVSRQQIRVVSYGKERPANYGHDEASHAQNRRVEFIYEATR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MMS2 Antibody
32970-05111 150 µg

Human MMS2 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal TGF beta 1/2/3 Antibody (1D11) [mFluor Violet 450 SE]
FAB1835MFV450 0.1 mL

Mouse Monoclonal TGF beta 1/2/3 Antibody (1D11) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Lentiviral human CCNH shRNA (UAS) - Lentiviral human CCNH shRNA (UAS, RFP) plasmid
GTR15323140 1 Vial

Lentiviral human CCNH shRNA (UAS) - Lentiviral human CCNH shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
CTLA4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0526806 1.0 µg DNA

CTLA4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
STIP1 (Stress-induced-phosphoprotein 1, STI1, Hsc70/Hsp90-organizing Protein, Hop, P60, Renal Carcinoma Antigen NY-REN-11, STI1L, Transformation-sensitive Protein IEF SSP 3521, IEF-SSP-3521) APC
MBS6139330-01 0.1 mL

STIP1 (Stress-induced-phosphoprotein 1, STI1, Hsc70/Hsp90-organizing Protein, Hop, P60, Renal Carcinoma Antigen NY-REN-11, STI1L, Transformation-sensitive Protein IEF SSP 3521, IEF-SSP-3521) APC

Sign In for Pricing
View Details
STIP1 (Stress-induced-phosphoprotein 1, STI1, Hsc70/Hsp90-organizing Protein, Hop, P60, Renal Carcinoma Antigen NY-REN-11, STI1L, Transformation-sensitive Protein IEF SSP 3521, IEF-SSP-3521) APC
MBS6139330-02 5x 0.1 mL

STIP1 (Stress-induced-phosphoprotein 1, STI1, Hsc70/Hsp90-organizing Protein, Hop, P60, Renal Carcinoma Antigen NY-REN-11, STI1L, Transformation-sensitive Protein IEF SSP 3521, IEF-SSP-3521) APC

Sign In for Pricing
View Details