Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal)

Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Legionella pneumophila. Target Name: Peptidoglycan-associated lipoprotein (pal) . Accession Number: P26493; pal. Expression Region: 22-176aa. Tag Info: Tag-Free. Theoretical MW: 17.0kda. Target Synonyms: PAL; 19 kDa surface antigen; PPL Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal) is a purified Recombinant Protein.

Accession Number

P26493; pal

Expression Region

22-176aa

Host

E. coli

Target

Peptidoglycan-associated lipoprotein (pal)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

PAL; 19 kDa surface antigen; PPL

Species

Legionella pneumophila

Protein Name

Recombinant Protein

AA Sequence

CSKTPGSADGGAAVGDGDATAQGLGQMTHFAGQEPGESYTTQAPHNQLYLFAYDDSTLASKYLPSVNAQAEYLKTHPGARVMIAGHTDERGSREYNVALGERRADTVAEILRMAGVSRQQIRVVSYGKERPANYGHDEASHAQNRRVEFIYEATR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM108 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
46864111 3x 1.0 µg

TMEM108 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Chromobacterium violaceum Protoheme IX farnesyltransferase 1 (ctaB1), partial
MBS7089314 Inquire

Recombinant Chromobacterium violaceum Protoheme IX farnesyltransferase 1 (ctaB1), partial

Sign In for Pricing
View Details
LOC680547 3'UTR GFP Stable Cell Line
TU260640 1.0 mL

LOC680547 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Canine Lysophosphatidic Acid Phosphatase Type 6 (ACP6) ELISA Kit
MBS2611128-01 48 Well

Canine Lysophosphatidic Acid Phosphatase Type 6 (ACP6) ELISA Kit

Sign In for Pricing
View Details
Canine Lysophosphatidic Acid Phosphatase Type 6 (ACP6) ELISA Kit
MBS2611128-02 96 Well

Canine Lysophosphatidic Acid Phosphatase Type 6 (ACP6) ELISA Kit

Sign In for Pricing
View Details
Canine Lysophosphatidic Acid Phosphatase Type 6 (ACP6) ELISA Kit
MBS2611128-03 5x 96 Well

Canine Lysophosphatidic Acid Phosphatase Type 6 (ACP6) ELISA Kit

Sign In for Pricing
View Details