Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Autographa californica nuclear polyhedrosis virus Uncharacterized 30.6 kDa protein in IAP2-VLF1 intergenic region

Recombinant Autographa californica nuclear polyhedrosis virus Uncharacterized 30.6 kDa protein in IAP2-VLF1 intergenic region is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Autographa californica nuclear polyhedrosis virus (AcMNPV) . Target Name: Uncharacterized 30.6 kDa protein in IAP2-VLF1 intergenic region. Accession Number: P41473. Expression Region: 1-265aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 38.0kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Autographa californica nuclear polyhedrosis virus Uncharacterized 30.6 kDa protein in IAP2-VLF1 intergenic region is a purified Recombinant Protein.

Accession Number

P41473

Expression Region

1-265aa

Host

E. coli

Target

Uncharacterized 30.6 kDa protein in IAP2-VLF1 intergenic region

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

38.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Autographa californica nuclear polyhedrosis virus (AcMNPV)

Protein Name

Recombinant Protein

AA Sequence

MKINLCNIQFQSLINLLNLQATTMSLLNSNKIKADLIPDEDDPKKITLRLNSVPEEHTDDNSSIDLPLTTPKQKDDFMNAIKSFETLNIEPDIVKTEQADAPATSGDNNRKVVDANVDEYTVDGLKLKSKYVAYYKCLKILVDFLVMYVSKEVSMKEYEQVYTLGRQLYEVLRSIFVDEPFKLWLERNTHEFDNNKDKILETLQSELKLALADKDKLKTCTFKDIITNLLNTKLDCKYDCADEYIKPNCIVDTYNCCNLVFKKET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (M2-7C10), CF568 conjugate, 0.1mg/mL
BNC680009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF740 conjugate, 0.1mg/mL
BNC740871-500 1x 500 µL

CD71 (66IG10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF640R conjugate, 0.1mg/mL
BNC400160-500 1x 500 µL

CD20 (B9E9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
BNC740669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF568 conjugate, 0.1mg/mL
BNC680322-500 1x 500 µL

CD3e (RIV9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF594 conjugate, 0.1mg/mL
BNC940525-500 1x 500 µL

CD63 (MX-49.129.5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details