Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana TATA-box-binding protein 1 (TBP1)

Recombinant Arabidopsis thaliana TATA-box-binding protein 1 (TBP1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Arabidopsis thaliana (Mouse-ear cress) . Target Name: TATA-box-binding protein 1 (TBP1) . Accession Number: P28147; TBP1. Expression Region: 1-200aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 35.3kda. Target Synonyms: AtTBP1; TATA sequence-binding protein 1; TBP-1; TATA-binding factor 1; TATA-box factor 1; Transcription initiation factor TFIID TBP-1 subunit Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Arabidopsis thaliana TATA-box-binding protein 1 (TBP1) is a purified Recombinant Protein.

Accession Number

P28147; TBP1

Expression Region

1-200aa

Host

E. coli

Target

TATA-box-binding protein 1 (TBP1)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

35.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

AtTBP1; TATA sequence-binding protein 1; TBP-1; TATA-binding factor 1; TATA-box factor 1; Transcription initiation factor TFIID TBP-1 subunit

Species

Arabidopsis thaliana (Mouse-ear cress)

Protein Name

Recombinant Protein

AA Sequence

MTDQGLEGSNPVDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKIQQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C12orf66 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0293107 1.0 µg DNA

C12orf66 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
PRKD3 CRISPRa sgRNA lentivector (set of three targets)(Rat)
37650126 3x 1.0µg DNA

PRKD3 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
IFNAR2 goat polyclonal antibody, Purified
AP22577PU-N 50 µg

IFNAR2 goat polyclonal antibody, Purified

Sign In for Pricing
View Details
Polyclonal CCR4 Antibody
APR00207G 0.1mg

Polyclonal CCR4 Antibody

Sign In for Pricing
View Details
Rabbit Mitotic Checkpoint Serine/Threonine-Protein Kinase BUB1 Beta (BUB1B) ELISA Kit
MBS9350065 Inquire

Rabbit Mitotic Checkpoint Serine/Threonine-Protein Kinase BUB1 Beta (BUB1B) ELISA Kit

Sign In for Pricing
View Details
Tissue, Total RNA, Human Disease, Alzheimer's Disease, Occipital Lobe, BioGenomicsTM
T5595-7441 10 µg

Tissue, Total RNA, Human Disease, Alzheimer's Disease, Occipital Lobe, BioGenomicsTM

Sign In for Pricing
View Details