Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana TATA-box-binding protein 1 (TBP1)

Recombinant Arabidopsis thaliana TATA-box-binding protein 1 (TBP1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Arabidopsis thaliana (Mouse-ear cress) . Target Name: TATA-box-binding protein 1 (TBP1) . Accession Number: P28147; TBP1. Expression Region: 1-200aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 35.3kda. Target Synonyms: AtTBP1; TATA sequence-binding protein 1; TBP-1; TATA-binding factor 1; TATA-box factor 1; Transcription initiation factor TFIID TBP-1 subunit Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Arabidopsis thaliana TATA-box-binding protein 1 (TBP1) is a purified Recombinant Protein.

Accession Number

P28147; TBP1

Expression Region

1-200aa

Host

E. coli

Target

TATA-box-binding protein 1 (TBP1)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

35.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

AtTBP1; TATA sequence-binding protein 1; TBP-1; TATA-binding factor 1; TATA-box factor 1; Transcription initiation factor TFIID TBP-1 subunit

Species

Arabidopsis thaliana (Mouse-ear cress)

Protein Name

Recombinant Protein

AA Sequence

MTDQGLEGSNPVDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKIQQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-6507-3p mimic
HY-R01941-01 5 nmol

Hsa-miR-6507-3p mimic

Sign In for Pricing
View Details
Hsa-miR-6507-3p mimic
HY-R01941-02 20 nmol

Hsa-miR-6507-3p mimic

Sign In for Pricing
View Details
GYLTL1B siRNA (Mouse)
CRN2650-01 15 nmol

GYLTL1B siRNA (Mouse)

Sign In for Pricing
View Details
GYLTL1B siRNA (Mouse)
CRN2650-02 30 nmol

GYLTL1B siRNA (Mouse)

Sign In for Pricing
View Details
Rabbit Polyclonal UGT2B4 Antibody
NBP2-54718-25ul 25 µL

Rabbit Polyclonal UGT2B4 Antibody

Sign In for Pricing
View Details
FNDC3CP Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV761546 1.0 µg DNA

FNDC3CP Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details