Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana TATA-box-binding protein 1 (TBP1)

Recombinant Arabidopsis thaliana TATA-box-binding protein 1 (TBP1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Arabidopsis thaliana (Mouse-ear cress) . Target Name: TATA-box-binding protein 1 (TBP1) . Accession Number: P28147; TBP1. Expression Region: 1-200aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 35.3kda. Target Synonyms: AtTBP1; TATA sequence-binding protein 1; TBP-1; TATA-binding factor 1; TATA-box factor 1; Transcription initiation factor TFIID TBP-1 subunit Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Arabidopsis thaliana TATA-box-binding protein 1 (TBP1) is a purified Recombinant Protein.

Accession Number

P28147; TBP1

Expression Region

1-200aa

Host

E. coli

Target

TATA-box-binding protein 1 (TBP1)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

35.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

AtTBP1; TATA sequence-binding protein 1; TBP-1; TATA-binding factor 1; TATA-box factor 1; Transcription initiation factor TFIID TBP-1 subunit

Species

Arabidopsis thaliana (Mouse-ear cress)

Protein Name

Recombinant Protein

AA Sequence

MTDQGLEGSNPVDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKIQQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Nucleobindin 1 (NUCB1)
MBS2034499-01 0.01 mg

Recombinant Nucleobindin 1 (NUCB1)

Sign In for Pricing
View Details
Recombinant Nucleobindin 1 (NUCB1)
MBS2034499-02 0.05 mg

Recombinant Nucleobindin 1 (NUCB1)

Sign In for Pricing
View Details
Recombinant Nucleobindin 1 (NUCB1)
MBS2034499-03 0.1 mg

Recombinant Nucleobindin 1 (NUCB1)

Sign In for Pricing
View Details
Recombinant Nucleobindin 1 (NUCB1)
MBS2034499-04 0.2 mg

Recombinant Nucleobindin 1 (NUCB1)

Sign In for Pricing
View Details
Recombinant Nucleobindin 1 (NUCB1)
MBS2034499-05 0.5 mg

Recombinant Nucleobindin 1 (NUCB1)

Sign In for Pricing
View Details
Recombinant Nucleobindin 1 (NUCB1)
MBS2034499-06 1 mg

Recombinant Nucleobindin 1 (NUCB1)

Sign In for Pricing
View Details