Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana TATA-box-binding protein 1 (TBP1)

Recombinant Arabidopsis thaliana TATA-box-binding protein 1 (TBP1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Arabidopsis thaliana (Mouse-ear cress) . Target Name: TATA-box-binding protein 1 (TBP1) . Accession Number: P28147; TBP1. Expression Region: 1-200aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 35.3kda. Target Synonyms: AtTBP1; TATA sequence-binding protein 1; TBP-1; TATA-binding factor 1; TATA-box factor 1; Transcription initiation factor TFIID TBP-1 subunit Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Arabidopsis thaliana TATA-box-binding protein 1 (TBP1) is a purified Recombinant Protein.

Accession Number

P28147; TBP1

Expression Region

1-200aa

Host

E. coli

Target

TATA-box-binding protein 1 (TBP1)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

35.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

AtTBP1; TATA sequence-binding protein 1; TBP-1; TATA-binding factor 1; TATA-box factor 1; Transcription initiation factor TFIID TBP-1 subunit

Species

Arabidopsis thaliana (Mouse-ear cress)

Protein Name

Recombinant Protein

AA Sequence

MTDQGLEGSNPVDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKIQQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPX2 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-4285R-PerCP-Cy5.5 100 µL

TPX2 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Trpm4 shRNA (UAS) - Lentiviral mouse Trpm4 shRNA (UAS) plasmid
GTR15228187 1 Vial

Lentiviral mouse Trpm4 shRNA (UAS) - Lentiviral mouse Trpm4 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Mouse Monoclonal ADAM33 Antibody (508101) [Alexa Fluor 488]
FAB5565G 0.1 mL

Mouse Monoclonal ADAM33 Antibody (508101) [Alexa Fluor 488]

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein C1E8.03c (SPBC1E8.03c), partial
MBS7070786 Inquire

Recombinant Schizosaccharomyces pombe Uncharacterized protein C1E8.03c (SPBC1E8.03c), partial

Sign In for Pricing
View Details
Recombinant Vaccinia virus Protein A47 (MVA160L, ACAM3000_MVA_160)
MBS1068802-01 0.02 mg (E-Coli)

Recombinant Vaccinia virus Protein A47 (MVA160L, ACAM3000_MVA_160)

Sign In for Pricing
View Details
Recombinant Vaccinia virus Protein A47 (MVA160L, ACAM3000_MVA_160)
MBS1068802-02 0.1 mg (E-Coli)

Recombinant Vaccinia virus Protein A47 (MVA160L, ACAM3000_MVA_160)

Sign In for Pricing
View Details