Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana TATA-box-binding protein 1 (TBP1)

Recombinant Arabidopsis thaliana TATA-box-binding protein 1 (TBP1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Arabidopsis thaliana (Mouse-ear cress) . Target Name: TATA-box-binding protein 1 (TBP1) . Accession Number: P28147; TBP1. Expression Region: 1-200aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 35.3kda. Target Synonyms: AtTBP1; TATA sequence-binding protein 1; TBP-1; TATA-binding factor 1; TATA-box factor 1; Transcription initiation factor TFIID TBP-1 subunit Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Arabidopsis thaliana TATA-box-binding protein 1 (TBP1) is a purified Recombinant Protein.

Accession Number

P28147; TBP1

Expression Region

1-200aa

Host

E. coli

Target

TATA-box-binding protein 1 (TBP1)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

35.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

AtTBP1; TATA sequence-binding protein 1; TBP-1; TATA-binding factor 1; TATA-box factor 1; Transcription initiation factor TFIID TBP-1 subunit

Species

Arabidopsis thaliana (Mouse-ear cress)

Protein Name

Recombinant Protein

AA Sequence

MTDQGLEGSNPVDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKIQQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EphB1 Protein Vector (Rat) (pPB-C-His)
PV266354 500 ng

EphB1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
CD153/CD30L/TNFSF8 Protein (Human)
P513880 100 µg

CD153/CD30L/TNFSF8 Protein (Human)

Sign In for Pricing
View Details
STX2 Recombinant Protein (Mouse)
RP176258 100 µg

STX2 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
SOSTDC1, CT (SOSTDC1, USAG1, Sclerostin domain-containing protein 1, Ectodermal BMP inhibitor, Uterine sensitization-associated gene 1 protein) (Azide free) (HRP) discontinued
042149-HRP 200 µL

SOSTDC1, CT (SOSTDC1, USAG1, Sclerostin domain-containing protein 1, Ectodermal BMP inhibitor, Uterine sensitization-associated gene 1 protein) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Mpdu1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4472302 1.0 µg DNA

Mpdu1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Rat fatty acid binding protein (h-FABP) ELISA Kit
EIA05787r 1 Kit

Rat fatty acid binding protein (h-FABP) ELISA Kit

Sign In for Pricing
View Details