Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transcription factor Jun (JUN)

Recombinant Human Transcription factor Jun (JUN) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Transcription factor Jun (JUN) . Accession Number: P05412; JUN. Expression Region: 1-331aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 43.1kda. Target Synonyms: Activator protein 1; AP1; Proto-oncogene c-Jun; Transcription factor AP-1 subunit Jun; V-jun avian sarcoma virus 17 oncogene homolog; p39 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Transcription factor Jun (JUN) is a purified Recombinant Protein.

Accession Number

P05412; JUN

Expression Region

1-331aa

Host

E. coli

Target

Transcription factor Jun (JUN)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

43.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Activator protein 1; AP1; Proto-oncogene c-Jun; Transcription factor AP-1 subunit Jun; V-jun avian sarcoma virus 17 oncogene homolog; p39

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Kv2.1 (KCNB1) Human qPCR Primer Pair (NM_004975)
HP208204 200 Reactions

Kv2.1 (KCNB1) Human qPCR Primer Pair (NM_004975)

Ask
View Details
Mouse Monoclonal SARS-CoV-2 Spike Antibody (5H4C5) [CoraFluor 1]
NBP3-14792CL1 0.1 mL

Mouse Monoclonal SARS-CoV-2 Spike Antibody (5H4C5) [CoraFluor 1]

Ask
View Details
SGK1 (Serine/threonine Protein Kinase SGK, Serine/threonine Protein Kinase Sgk1, Serine/threonine-Protein Kinase Sgk1, Serum and glucocorticoid Regulated Kinase, Serum/glucocorticoid Regulated Kinase 1, Serum/glucocorticoid Regulated Kinase, Serum/glucocorticoid-Regulated Kinase 1, SGK 1, SGK, SGK1, SGK1) discontinued
225780-01 50 µL

SGK1 (Serine/threonine Protein Kinase SGK, Serine/threonine Protein Kinase Sgk1, Serine/threonine-Protein Kinase Sgk1, Serum and glucocorticoid Regulated Kinase, Serum/glucocorticoid Regulated Kinase 1, Serum/glucocorticoid Regulated Kinase, Serum/glucocorticoid-Regulated Kinase 1, SGK 1, SGK, SGK1, SGK1) discontinued

Ask
View Details
SGK1 (Serine/threonine Protein Kinase SGK, Serine/threonine Protein Kinase Sgk1, Serine/threonine-Protein Kinase Sgk1, Serum and glucocorticoid Regulated Kinase, Serum/glucocorticoid Regulated Kinase 1, Serum/glucocorticoid Regulated Kinase, Serum/glucocorticoid-Regulated Kinase 1, SGK 1, SGK, SGK1, SGK1) discontinued
225780-02 100 µL

SGK1 (Serine/threonine Protein Kinase SGK, Serine/threonine Protein Kinase Sgk1, Serine/threonine-Protein Kinase Sgk1, Serum and glucocorticoid Regulated Kinase, Serum/glucocorticoid Regulated Kinase 1, Serum/glucocorticoid Regulated Kinase, Serum/glucocorticoid-Regulated Kinase 1, SGK 1, SGK, SGK1, SGK1) discontinued

Ask
View Details
Tp53rk, ID (Tp53rk, Prpk, Trp53rk, TP53-regulating kinase, Nori-2, p53-related protein kinase) (MaxLight 550)
MBS6357545-01 0.1 mL

Tp53rk, ID (Tp53rk, Prpk, Trp53rk, TP53-regulating kinase, Nori-2, p53-related protein kinase) (MaxLight 550)

Ask
View Details
Tp53rk, ID (Tp53rk, Prpk, Trp53rk, TP53-regulating kinase, Nori-2, p53-related protein kinase) (MaxLight 550)
MBS6357545-02 5x 0.1 mL

Tp53rk, ID (Tp53rk, Prpk, Trp53rk, TP53-regulating kinase, Nori-2, p53-related protein kinase) (MaxLight 550)

Ask
View Details