Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bone morphogenetic protein 3B (GDF10)

Recombinant Human Bone morphogenetic protein 3B (GDF10) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Bone morphogenetic protein 3B (GDF10) . Accession Number: P55107; GDF10. Expression Region: 369-478aa. Tag Info: N-terminal 10xHis-tagged. Theoretical MW: 16.1kda. Target Synonyms: GDF-10; Bone morphogenetic protein 3B; BMP-3B; Bone-inducing protein; BIP Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Bone morphogenetic protein 3B (GDF10) is a purified Recombinant Protein.

Accession Number

P55107; GDF10

Expression Region

369-478aa

Host

E. coli

Target

Bone morphogenetic protein 3B (GDF10)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

16.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

GDF-10; Bone morphogenetic protein 3B; BMP-3B; Bone-inducing protein; BIP

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

QWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPSNHATIQSIVRAVGIIPGIPEPCCVPDKMNSLGVLFLDENRNVVLKVYPNMSVDTCACR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCTD9 Rabbit Polyclonal Antibody
TA344985 100 µL

KCTD9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cetn3 siRNA Oligos set (Rat)
15962176 3x 5 nmol

Cetn3 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Human heat shock protein 27, HSP-27 ELISA Kit
SL0827Hu-01 48 Tests

Human heat shock protein 27, HSP-27 ELISA Kit

Sign In for Pricing
View Details
Human heat shock protein 27, HSP-27 ELISA Kit
SL0827Hu-02 96 Tests

Human heat shock protein 27, HSP-27 ELISA Kit

Sign In for Pricing
View Details
Phosphoribosyl pyrophosphate amidotransferase Antibody
orb1322056 100 µL

Phosphoribosyl pyrophosphate amidotransferase Antibody

Sign In for Pricing
View Details
Mouse C57 Jugular Vein Frozen Sections*
MF-812-C57 10 Slides

Mouse C57 Jugular Vein Frozen Sections*

Sign In for Pricing
View Details