Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bone morphogenetic protein 3B (GDF10)

Recombinant Human Bone morphogenetic protein 3B (GDF10) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Bone morphogenetic protein 3B (GDF10) . Accession Number: P55107; GDF10. Expression Region: 369-478aa. Tag Info: N-terminal 10xHis-tagged. Theoretical MW: 16.1kda. Target Synonyms: GDF-10; Bone morphogenetic protein 3B; BMP-3B; Bone-inducing protein; BIP Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Bone morphogenetic protein 3B (GDF10) is a purified Recombinant Protein.

Accession Number

P55107; GDF10

Expression Region

369-478aa

Host

E. coli

Target

Bone morphogenetic protein 3B (GDF10)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

16.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

GDF-10; Bone morphogenetic protein 3B; BMP-3B; Bone-inducing protein; BIP

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

QWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPSNHATIQSIVRAVGIIPGIPEPCCVPDKMNSLGVLFLDENRNVVLKVYPNMSVDTCACR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLEKHG5 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-12455R-BF350 100 µL

PLEKHG5 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Recombinant Mouse Tnfrsf17 Protein, Fc/His-tagged, Alexa Fluor 647 conjugated
Tnfrsf17-2266MAF647 20 μg- 50 μg- 100 μg

Recombinant Mouse Tnfrsf17 Protein, Fc/His-tagged, Alexa Fluor 647 conjugated

Sign In for Pricing
View Details
CMTM7 (NM_138410) Human Tagged ORF Clone
RC204059 10 µg

CMTM7 (NM_138410) Human Tagged ORF Clone

Sign In for Pricing
View Details
Vmn1r142 Mouse siRNA Oligo Duplex (Locus ID 667464)
SR408976 1 Kit

Vmn1r142 Mouse siRNA Oligo Duplex (Locus ID 667464)

Sign In for Pricing
View Details
Slc43a1 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6323202 1.0 µg DNA

Slc43a1 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
FAM129C CRISPR Knock Out 293T Cell Line (Human)
19758141 1x 10^6 Cells / 1.0 mL

FAM129C CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details