Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human IL12B&IL12A Heterodimer Protein , Active Protein

Recombinant Human IL12B&IL12A Heterodimer Protein , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: IL12B&IL12A Heterodimer Protein. Accession Number: P29460 & P29459; IL12B&IL12A. Expression Region: 23-328aa (IL12B) & 23-219aa (IL12A) . Tag Info: C-terminal 10xHis-tagged & C-terminal Flag-tagged. Theoretical MW: 39.7kda & 27.2kda. Target Synonyms: Cytotoxic lymphocyte maturation factor; CLMF; IL-12; NK cell stimulatory factor; NKSF Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human IL12B&IL12A Heterodimer Protein , Active Protein is a purified Active Recombinant Protein.

Accession Number

P29460 & P29459; IL12B&IL12A

Expression Region

23-328aa (IL12B) & 23-219aa (IL12A)

Host

Mammalian Cells

Target

IL12B&IL12A Heterodimer Protein

Conjugation

Unconjugated

Tag

C-Terminal 10xHis-Tagged & C-Terminal Flag-Tagged

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Heterodimer

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

39.7kDa/27.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cytotoxic lymphocyte maturation factor; CLMF; IL-12; NK cell stimulatory factor; NKSF

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS&RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPINI2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2126705 3x 1.0 µg

SERPINI2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
RAC3 Protein Vector (Mouse) (pPM-C-His)
PV221937 500 ng

RAC3 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Gamma Tubulin Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-61186R-BF350-01 20 µL

Gamma Tubulin Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Gamma Tubulin Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-61186R-BF350-02 100 µL

Gamma Tubulin Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Rat Monoclonal HSF1 Antibody (10H4) [Janelia Fluor 549]
NBP2-42205JF549 0.1 mL

Rat Monoclonal HSF1 Antibody (10H4) [Janelia Fluor 549]

Sign In for Pricing
View Details
Recombinant Escherichia coli O9:H4 UPF0306 protein yhbP (yhbP)
MBS1054518-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O9:H4 UPF0306 protein yhbP (yhbP)

Sign In for Pricing
View Details