Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human IL12B&IL12A Heterodimer Protein , Active Protein

Recombinant Human IL12B&IL12A Heterodimer Protein , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: IL12B&IL12A Heterodimer Protein. Accession Number: P29460 & P29459; IL12B&IL12A. Expression Region: 23-328aa (IL12B) & 23-219aa (IL12A) . Tag Info: C-terminal 10xHis-tagged & C-terminal Flag-tagged. Theoretical MW: 39.7kda & 27.2kda. Target Synonyms: Cytotoxic lymphocyte maturation factor; CLMF; IL-12; NK cell stimulatory factor; NKSF Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human IL12B&IL12A Heterodimer Protein , Active Protein is a purified Active Recombinant Protein.

Accession Number

P29460 & P29459; IL12B&IL12A

Expression Region

23-328aa (IL12B) & 23-219aa (IL12A)

Host

Mammalian Cells

Target

IL12B&IL12A Heterodimer Protein

Conjugation

Unconjugated

Tag

C-Terminal 10xHis-Tagged & C-Terminal Flag-Tagged

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Heterodimer

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

39.7kDa/27.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cytotoxic lymphocyte maturation factor; CLMF; IL-12; NK cell stimulatory factor; NKSF

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS&RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Morphine (2F11) Monoclonal Antibody, PE-Cy7 Conjugated
bsm-2129M-PE-Cy7 100 µL

Morphine (2F11) Monoclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
GRIN1 antibody (Splice Variant C2)
70R-15019 25 ug

GRIN1 antibody (Splice Variant C2)

Sign In for Pricing
View Details
Fmoc Isothiocyanate
450266-01 250 mg

Fmoc Isothiocyanate

Sign In for Pricing
View Details
Fmoc Isothiocyanate
450266-02 500 mg

Fmoc Isothiocyanate

Sign In for Pricing
View Details
LIPC, NT (LIPC, HTGL, Hepatic triacylglycerol lipase, Lipase member C) (FITC)
MBS6316408-01 0.2 mL

LIPC, NT (LIPC, HTGL, Hepatic triacylglycerol lipase, Lipase member C) (FITC)

Sign In for Pricing
View Details
LIPC, NT (LIPC, HTGL, Hepatic triacylglycerol lipase, Lipase member C) (FITC)
MBS6316408-02 5x 0.2 mL

LIPC, NT (LIPC, HTGL, Hepatic triacylglycerol lipase, Lipase member C) (FITC)

Sign In for Pricing
View Details