Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant African swine fever virus Uncharacterized protein K145R (Mal-059)

Recombinant African swine fever virus Uncharacterized protein K145R (Mal-059) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV) . Target Name: Uncharacterized protein K145R (Mal-059) . Accession Number: P0CA49; Mal-059. Expression Region: 1-145aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 30.1kda. Target Synonyms: pK145R Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant African swine fever virus Uncharacterized protein K145R (Mal-059) is a purified Recombinant Protein.

Accession Number

P0CA49; Mal-059

Expression Region

1-145aa

Host

E. coli

Target

Uncharacterized protein K145R (Mal-059)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

30.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

PK145R

Species

African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV)

Protein Name

Recombinant Protein

AA Sequence

MDHYLKKLEDIYKKLEGHPFLFSPSKTNEKEFITLLNQALASTQLYRSIQQLFLTMYKLDPIGFINYIKTSKQEYLCLLINPKLVTKFLKITSFKIYINFRLKTFYISPNKYNNFYTAPSEEKANHLLKEEKTWAKIVEEGGEES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wnt1 (Wingless-type MMTV (Mouse Mammary Tumor Virus) Integration Site Family Member) (MaxLight 490)
MBS6506142-01 0.1 mL

Wnt1 (Wingless-type MMTV (Mouse Mammary Tumor Virus) Integration Site Family Member) (MaxLight 490)

Sign In for Pricing
View Details
Wnt1 (Wingless-type MMTV (Mouse Mammary Tumor Virus) Integration Site Family Member) (MaxLight 490)
MBS6506142-02 5x 0.1 mL

Wnt1 (Wingless-type MMTV (Mouse Mammary Tumor Virus) Integration Site Family Member) (MaxLight 490)

Sign In for Pricing
View Details
Human C11orf44 knockout cell line
ABC-KH1667 1 Vial

Human C11orf44 knockout cell line

Sign In for Pricing
View Details
Anti-PDGF Receptor beta/PDGFRB Antibody Picoband® Fluoro647 Conjugated
A00096-1-Fluoro647 100 µg/Vial

Anti-PDGF Receptor beta/PDGFRB Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
GluR4 (Glutamate Receptor 4, GluR-4, AMPA-Selective Glutamate Receptor 4, GluR-D, Glutamate Receptor Ionotropic, AMPA 4, GluA4, GRIA4) discontinued. See G3500-23A
299403 100 µg

GluR4 (Glutamate Receptor 4, GluR-4, AMPA-Selective Glutamate Receptor 4, GluR-D, Glutamate Receptor Ionotropic, AMPA 4, GluA4, GRIA4) discontinued. See G3500-23A

Sign In for Pricing
View Details
DDC (dopa decarboxylase (aromatic L-amino acid decarboxylase) ) Antibody (against the N terminal of DDC)
ARP41425_T100 100 µL

DDC (dopa decarboxylase (aromatic L-amino acid decarboxylase) ) Antibody (against the N terminal of DDC)

Sign In for Pricing
View Details