Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant African swine fever virus Uncharacterized protein K145R (Mal-059)

Recombinant African swine fever virus Uncharacterized protein K145R (Mal-059) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV) . Target Name: Uncharacterized protein K145R (Mal-059) . Accession Number: P0CA49; Mal-059. Expression Region: 1-145aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 30.1kda. Target Synonyms: pK145R Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant African swine fever virus Uncharacterized protein K145R (Mal-059) is a purified Recombinant Protein.

Accession Number

P0CA49; Mal-059

Expression Region

1-145aa

Host

E. coli

Target

Uncharacterized protein K145R (Mal-059)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

30.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

PK145R

Species

African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV)

Protein Name

Recombinant Protein

AA Sequence

MDHYLKKLEDIYKKLEGHPFLFSPSKTNEKEFITLLNQALASTQLYRSIQQLFLTMYKLDPIGFINYIKTSKQEYLCLLINPKLVTKFLKITSFKIYINFRLKTFYISPNKYNNFYTAPSEEKANHLLKEEKTWAKIVEEGGEES

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Clinopodiside A
HY-N8496 1 Each

Clinopodiside A

Ask
View Details
Rabbit Monoclonal Parvalbumin Antibody (6C7K6)
NBP3-15664-100ul 100 µL

Rabbit Monoclonal Parvalbumin Antibody (6C7K6)

Ask
View Details
Zscan4f AAV Vector (Mouse) (CMV)
51976104 1 µg

Zscan4f AAV Vector (Mouse) (CMV)

Ask
View Details
MEK1, NT (MAPK/ERK Kinase 1, MEK 1, Dual Specificity Mitogen-Activated Protein Kinase Kinase 1, MAP Kinase Kinase 1, MAP2K1, MAPKK 1, MKK1, PRKMK1, ERK Activator Kinase 1) (MaxLight 490) discontinued
M2865-04A2-ML490 100 µL

MEK1, NT (MAPK/ERK Kinase 1, MEK 1, Dual Specificity Mitogen-Activated Protein Kinase Kinase 1, MAP Kinase Kinase 1, MAP2K1, MAPKK 1, MKK1, PRKMK1, ERK Activator Kinase 1) (MaxLight 490) discontinued

Ask
View Details
CD49d (Antigen CD49d, CD49d Antigen, CDw49d, Alpha 4 Subunit of VLA-4 Receptor, Integrin alpha IV, Integrin alpha 4, IA4, ITGA4, LPAM23, MGC90518, Very Late Activation Protein 4 Receptor Alpha 4 Subunit, VLA4, VLA-4) (HRP)
MBS6250632-01 0.1 mL

CD49d (Antigen CD49d, CD49d Antigen, CDw49d, Alpha 4 Subunit of VLA-4 Receptor, Integrin alpha IV, Integrin alpha 4, IA4, ITGA4, LPAM23, MGC90518, Very Late Activation Protein 4 Receptor Alpha 4 Subunit, VLA4, VLA-4) (HRP)

Ask
View Details
CD49d (Antigen CD49d, CD49d Antigen, CDw49d, Alpha 4 Subunit of VLA-4 Receptor, Integrin alpha IV, Integrin alpha 4, IA4, ITGA4, LPAM23, MGC90518, Very Late Activation Protein 4 Receptor Alpha 4 Subunit, VLA4, VLA-4) (HRP)
MBS6250632-02 5x 0.1 mL

CD49d (Antigen CD49d, CD49d Antigen, CDw49d, Alpha 4 Subunit of VLA-4 Receptor, Integrin alpha IV, Integrin alpha 4, IA4, ITGA4, LPAM23, MGC90518, Very Late Activation Protein 4 Receptor Alpha 4 Subunit, VLA4, VLA-4) (HRP)

Ask
View Details