Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Transforming growth factor beta-2 proprotein (TGFB2), partial

Recombinant Bovine Transforming growth factor beta-2 proprotein (TGFB2), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bovine (Bos taurus) . Target Name: Transforming growth factor beta-2 proprotein (TGFB2) . Accession Number: P21214; TGFB2. Expression Region: 303-414aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 20.2kda. Target Synonyms: Milk growth factor; MGF Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Bovine Transforming growth factor beta-2 proprotein (TGFB2), partial is a purified Recombinant Protein.

Accession Number

P21214; TGFB2

Expression Region

303-414aa

Host

E. coli

Target

Transforming growth factor beta-2 proprotein (TGFB2)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

20.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Milk growth factor; MGF

Species

Bovine (Bos taurus)

Protein Name

Recombinant Protein

AA Sequence

ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-C Antibody (Center) [AMM05384G]
AMM05384G-01 50 µL

HLA-C Antibody (Center) [AMM05384G]

Sign In for Pricing
View Details
HLA-C Antibody (Center) [AMM05384G]
AMM05384G-02 100 µL

HLA-C Antibody (Center) [AMM05384G]

Sign In for Pricing
View Details
HLA-C Antibody (Center) [AMM05384G]
AMM05384G-03 200 µL

HLA-C Antibody (Center) [AMM05384G]

Sign In for Pricing
View Details
HLA-C Antibody (Center) [AMM05384G]
AMM05384G-04 400 µL

HLA-C Antibody (Center) [AMM05384G]

Sign In for Pricing
View Details
TNFSF18 (Tumor Necrosis Factor Ligand Superfamily Member 18, AITRL, GITRL, TL6, hGITRL)
368472 100 µg

TNFSF18 (Tumor Necrosis Factor Ligand Superfamily Member 18, AITRL, GITRL, TL6, hGITRL)

Sign In for Pricing
View Details
CP045 Rabbit Polyclonal Antibody
BT-AP01812-01 20 µL

CP045 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details