Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Transforming growth factor beta-2 proprotein (TGFB2), partial

Recombinant Bovine Transforming growth factor beta-2 proprotein (TGFB2), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bovine (Bos taurus) . Target Name: Transforming growth factor beta-2 proprotein (TGFB2) . Accession Number: P21214; TGFB2. Expression Region: 303-414aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 20.2kda. Target Synonyms: Milk growth factor; MGF Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Bovine Transforming growth factor beta-2 proprotein (TGFB2), partial is a purified Recombinant Protein.

Accession Number

P21214; TGFB2

Expression Region

303-414aa

Host

E. coli

Target

Transforming growth factor beta-2 proprotein (TGFB2)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

20.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Milk growth factor; MGF

Species

Bovine (Bos taurus)

Protein Name

Recombinant Protein

AA Sequence

ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STMN1 Antibody (Phospho-Ser38)
OAAN02862-100UL 100 µL

STMN1 Antibody (Phospho-Ser38)

Sign In for Pricing
View Details
SLFNL1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
44362066 1.0 µg DNA

SLFNL1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
KR511 Rabbit Polyclonal Antibody
BT-AP10912-01 20 µL

KR511 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KR511 Rabbit Polyclonal Antibody
BT-AP10912-02 50 µL

KR511 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KR511 Rabbit Polyclonal Antibody
BT-AP10912-03 100 µL

KR511 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Klra17 Protein Vector (Rat) (pPM-C-His)
PV276593 500 ng

Klra17 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details