Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Collagen triple helix repeat-containing protein 1 (Cthrc1)

Recombinant Mouse Collagen triple helix repeat-containing protein 1 (Cthrc1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Collagen triple helix repeat-containing protein 1 (Cthrc1) . Accession Number: Q9D1D6; Cthrc1. Expression Region: 33-245aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 36.0kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Collagen triple helix repeat-containing protein 1 (Cthrc1) is a purified Recombinant Protein.

Accession Number

Q9D1D6; Cthrc1

Expression Region

33-245aa

Host

E. coli

Target

Collagen triple helix repeat-containing protein 1 (Cthrc1)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

36.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

SENPKVKQKALIRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPELNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGFR, Phosphorylated (Y1197) (Epidermal Growth Factor Receptor, ERBB, ERBB1, HER1, PIG61, MENA) (MaxLight 490)
MBS6415293-01 0.1 mL

EGFR, Phosphorylated (Y1197) (Epidermal Growth Factor Receptor, ERBB, ERBB1, HER1, PIG61, MENA) (MaxLight 490)

Sign In for Pricing
View Details
EGFR, Phosphorylated (Y1197) (Epidermal Growth Factor Receptor, ERBB, ERBB1, HER1, PIG61, MENA) (MaxLight 490)
MBS6415293-02 5x 0.1 mL

EGFR, Phosphorylated (Y1197) (Epidermal Growth Factor Receptor, ERBB, ERBB1, HER1, PIG61, MENA) (MaxLight 490)

Sign In for Pricing
View Details
CD284 Rabbit Polyclonal Antibody
orb665924-01 30 µL

CD284 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD284 Rabbit Polyclonal Antibody
orb665924-02 50 μL

CD284 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD284 Rabbit Polyclonal Antibody
orb665924-03 100 µL

CD284 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD284 Rabbit Polyclonal Antibody
orb665924-04 200 µL

CD284 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details