Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Collagen triple helix repeat-containing protein 1 (Cthrc1)

Recombinant Mouse Collagen triple helix repeat-containing protein 1 (Cthrc1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Collagen triple helix repeat-containing protein 1 (Cthrc1) . Accession Number: Q9D1D6; Cthrc1. Expression Region: 33-245aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 36.0kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Collagen triple helix repeat-containing protein 1 (Cthrc1) is a purified Recombinant Protein.

Accession Number

Q9D1D6; Cthrc1

Expression Region

33-245aa

Host

E. coli

Target

Collagen triple helix repeat-containing protein 1 (Cthrc1)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

36.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

SENPKVKQKALIRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPELNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EEF1A1P2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0655007 1.0 µg DNA

EEF1A1P2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
C-Myc Antibody
MBS541301-01 0.1 mg

C-Myc Antibody

Sign In for Pricing
View Details
C-Myc Antibody
MBS541301-02 5x 0.1 mg

C-Myc Antibody

Sign In for Pricing
View Details
AOF1, ID (Flavin-containing amine oxidase domain-containing protein 1, Lysine-specific histone demethylase 2, Lysine-specific histone demethylase 1B, LSD2, C6orf193, AOF1, KDM1B)
031934 200 µL

AOF1, ID (Flavin-containing amine oxidase domain-containing protein 1, Lysine-specific histone demethylase 2, Lysine-specific histone demethylase 1B, LSD2, C6orf193, AOF1, KDM1B)

Sign In for Pricing
View Details
VWF Peptide
DF15878-BP 1 mg

VWF Peptide

Sign In for Pricing
View Details
SKI-178 5mg
A22510-5 5 mg

SKI-178 5mg

Sign In for Pricing
View Details