Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bothrops atrox Zinc metalloproteinase atroxlysin-1

Recombinant Bothrops atrox Zinc metalloproteinase atroxlysin-1 is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bothrops atrox (Barba amarilla) (Fer-de-lance) . Target Name: Zinc metalloproteinase atroxlysin-1. Accession Number: P85420. Expression Region: 1-202aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 30.4kda. Target Synonyms: SVMP; Atroxlysin-I Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Bothrops atrox Zinc metalloproteinase atroxlysin-1 is a purified Recombinant Protein.

Accession Number

P85420

Expression Region

1-202aa

Host

E. coli

Target

Zinc metalloproteinase atroxlysin-1

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

30.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

SVMP; Atroxlysin-I

Species

Bothrops atrox (Barba amarilla) (Fer-de-lance)

Protein Name

Recombinant Protein

AA Sequence

TPEQQRYVDLFIVVDHGMFMKYNGNSDKIRRRIHQMVNIMKEAYSTMYIDILLTGVEIWSNKDLINVQPAAPQTLDSFGEWRKTDLLNRKSHDNAQLLTSTDFNGPTIGLAYVGSMCDPKRSTGVIQDHSEQDLMVAITMAHELGHNLGISHDTGSCSCGGYSCIMSPVLSHEPSKYFSDCSYIQCWDFIMKENPQCILNKR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Aminopeptidase N ELISA Kit
MBS9428741-01 96 Tests

Rat Aminopeptidase N ELISA Kit

Sign In for Pricing
View Details
Rat Aminopeptidase N ELISA Kit
MBS9428741-02 5x 96 Tests

Rat Aminopeptidase N ELISA Kit

Sign In for Pricing
View Details
BCR (Breakpoint Cluster Region Protein, Renal Carcinoma Antigen NY-REN-26, BCR1, D22S11) (MaxLight 405)
MBS6189071-01 0.1 mL

BCR (Breakpoint Cluster Region Protein, Renal Carcinoma Antigen NY-REN-26, BCR1, D22S11) (MaxLight 405)

Sign In for Pricing
View Details
BCR (Breakpoint Cluster Region Protein, Renal Carcinoma Antigen NY-REN-26, BCR1, D22S11) (MaxLight 405)
MBS6189071-02 5x 0.1 mL

BCR (Breakpoint Cluster Region Protein, Renal Carcinoma Antigen NY-REN-26, BCR1, D22S11) (MaxLight 405)

Sign In for Pricing
View Details
GYPB Human qPCR Primer Pair (NM_002100)
HP205841 200 Reactions

GYPB Human qPCR Primer Pair (NM_002100)

Sign In for Pricing
View Details
Guinea pig Kit ligand (KITLG) ELISA Kit
MBS2604886-01 48 Well

Guinea pig Kit ligand (KITLG) ELISA Kit

Sign In for Pricing
View Details