Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Leukocyte immunoglobulin-like receptor subfamily B member 3 (Lilrb3), partial

Recombinant Mouse Leukocyte immunoglobulin-like receptor subfamily B member 3 (Lilrb3), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Leukocyte immunoglobulin-like receptor subfamily B member 3 (Lilrb3) . Accession Number: P97484; Lilrb3. Expression Region: 25-642aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 70.8kda. Target Synonyms: LIR-3; Leukocyte immunoglobulin-like receptor 3; Cell-surface glycoprotein p91; Paired immunoglobulin-like receptor B; PIR-B Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Leukocyte immunoglobulin-like receptor subfamily B member 3 (Lilrb3), partial is a purified Recombinant Protein.

Accession Number

P97484; Lilrb3

Expression Region

25-642aa

Host

Mammalian Cells

Target

Leukocyte immunoglobulin-like receptor subfamily B member 3 (Lilrb3)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

70.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

LIR-3; Leukocyte immunoglobulin-like receptor 3; Cell-surface glycoprotein p91; Paired immunoglobulin-like receptor B; PIR-B

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

SLPKPILRVQPDSVVSRRTKVTFLCEETIGANEYRLYKDGKLYKTVTKNKQKPENKAEFSFSNVDLSNAGQYRCSYSTQYKSSGYSDLLELVVTGHYWTPSLLAQASPVVTSGGYVTLQCESWHNDHKFILTVEGPQKLSWTQDSQYNYSTRKYHALFSVGPVTPNQRWICRCYSYDRNRPYVWSPPSESVELLVSGNLQKPTIKAEPGSVITSKRAMTIWCQGNLDAEVYFLHNEKSQKTQSTQTLQEPGNKGKFFIPSVTLQHAGQYRCYCYGSAGWSQPSDTLELVVTGIYEYYEPRLSVLPSPVVTAGGNMTLHCASDFPYDKFILTKEDKKFGNSLDTEHISSSGQYRALFIIGPTTPTHTGAFRCYGYYKNAPQLWSVPSALQQILISGLSKKPSLLTHQGHILDPGMTLTLQCFSDINYDRFALHKVGGADIMQHSSQQTDTGFSVANFTLGYVSSSTGGQYRCYGAHNLSSEWSASSEPLDILITGQLPLTPSLSVQPNHTVHSGETVSLLCWSMDSVDTFILSKEGSAQQPLRLKSKSHDQQSQAEFSMSAVTSHLSGTYRCYGAQDSSFYLLSSASAPVELTVSGPIETSTPPPTMSMPLGGLHMYLK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP8A1 Antibody
A13629-100UL 100 µL

ATP8A1 Antibody

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans gcy-21 Polyclonal Antibody
MBS7186575 Inquire

Rabbit anti-Caenorhabditis elegans gcy-21 Polyclonal Antibody

Sign In for Pricing
View Details
Myo19 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4674702 1.0 µg DNA

Myo19 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
RGS21 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1818708 1.0 µg DNA

RGS21 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Rat CLU (Clusterin) ELISA Kit
RE2853R-01 48 Tests

Rat CLU (Clusterin) ELISA Kit

Sign In for Pricing
View Details
Rat CLU (Clusterin) ELISA Kit
RE2853R-02 96 Tests

Rat CLU (Clusterin) ELISA Kit

Sign In for Pricing
View Details