Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Leukocyte immunoglobulin-like receptor subfamily B member 3 (Lilrb3), partial

Recombinant Mouse Leukocyte immunoglobulin-like receptor subfamily B member 3 (Lilrb3), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Leukocyte immunoglobulin-like receptor subfamily B member 3 (Lilrb3) . Accession Number: P97484; Lilrb3. Expression Region: 25-642aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 70.8kda. Target Synonyms: LIR-3; Leukocyte immunoglobulin-like receptor 3; Cell-surface glycoprotein p91; Paired immunoglobulin-like receptor B; PIR-B Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Leukocyte immunoglobulin-like receptor subfamily B member 3 (Lilrb3), partial is a purified Recombinant Protein.

Accession Number

P97484; Lilrb3

Expression Region

25-642aa

Host

Mammalian Cells

Target

Leukocyte immunoglobulin-like receptor subfamily B member 3 (Lilrb3)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

70.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

LIR-3; Leukocyte immunoglobulin-like receptor 3; Cell-surface glycoprotein p91; Paired immunoglobulin-like receptor B; PIR-B

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

SLPKPILRVQPDSVVSRRTKVTFLCEETIGANEYRLYKDGKLYKTVTKNKQKPENKAEFSFSNVDLSNAGQYRCSYSTQYKSSGYSDLLELVVTGHYWTPSLLAQASPVVTSGGYVTLQCESWHNDHKFILTVEGPQKLSWTQDSQYNYSTRKYHALFSVGPVTPNQRWICRCYSYDRNRPYVWSPPSESVELLVSGNLQKPTIKAEPGSVITSKRAMTIWCQGNLDAEVYFLHNEKSQKTQSTQTLQEPGNKGKFFIPSVTLQHAGQYRCYCYGSAGWSQPSDTLELVVTGIYEYYEPRLSVLPSPVVTAGGNMTLHCASDFPYDKFILTKEDKKFGNSLDTEHISSSGQYRALFIIGPTTPTHTGAFRCYGYYKNAPQLWSVPSALQQILISGLSKKPSLLTHQGHILDPGMTLTLQCFSDINYDRFALHKVGGADIMQHSSQQTDTGFSVANFTLGYVSSSTGGQYRCYGAHNLSSEWSASSEPLDILITGQLPLTPSLSVQPNHTVHSGETVSLLCWSMDSVDTFILSKEGSAQQPLRLKSKSHDQQSQAEFSMSAVTSHLSGTYRCYGAQDSSFYLLSSASAPVELTVSGPIETSTPPPTMSMPLGGLHMYLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF647 conjugate, 0.1mg/mL
BNC470151-100 1x 100 µL

CD11a (Cris-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF594 conjugate, 0.1mg/mL
BNC940175-100 1x 100 µL

CD46 (122.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL
BNC680460-100 1x 100 µL

CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL
BNC040391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL
BNC040352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MyoD1 (5.8A), CF568 conjugate, 0.1mg/mL
BNC680191-100 1x 100 µL

MyoD1 (5.8A), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details