Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fragile X mental retardation syndrome-related protein 1 (FXR1), partial

Recombinant Human Fragile X mental retardation syndrome-related protein 1 (FXR1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Fragile X mental retardation syndrome-related protein 1 (FXR1) . Accession Number: P51114; FXR1. Expression Region: 281-358aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 14.7kda. Target Synonyms: FMR1 autosomal homolog 1; hFXR1p Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Fragile X mental retardation syndrome-related protein 1 (FXR1), partial is a purified Recombinant Protein.

Accession Number

P51114; FXR1

Expression Region

281-358aa

Host

E. coli

Target

Fragile X mental retardation syndrome-related protein 1 (FXR1)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

14.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

FMR1 autosomal homolog 1; hFXR1p

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

FVEDFIQVPRNLVGKVIGKNGKVIQEIVDKSGVVRVRIEGDNENKLPREDGMVPFVFVGTKESIGNVQVLLEYHIAYL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGAC Polyclonal Antibody
UB-GEN-6333 100 µL

MAGAC Polyclonal Antibody

Sign In for Pricing
View Details
Pla2g4e ORF Vector (Mouse) (pORF)
ORF054183 1.0 µg DNA

Pla2g4e ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
FKBP7 (NM_181342) Human Over-expression Lysate
LS051661-100ug 100 µg

FKBP7 (NM_181342) Human Over-expression Lysate

Sign In for Pricing
View Details
IL2RB siRNA (Rat)
CRR0927-01 15 nmol

IL2RB siRNA (Rat)

Sign In for Pricing
View Details
IL2RB siRNA (Rat)
CRR0927-02 30 nmol

IL2RB siRNA (Rat)

Sign In for Pricing
View Details
Human Oxysterol Binding Protein Like 3 (OSBPL3) ELISA Kit
abx381987 96 Tests

Human Oxysterol Binding Protein Like 3 (OSBPL3) ELISA Kit

Sign In for Pricing
View Details