Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fragile X mental retardation syndrome-related protein 1 (FXR1), partial

Recombinant Human Fragile X mental retardation syndrome-related protein 1 (FXR1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Fragile X mental retardation syndrome-related protein 1 (FXR1) . Accession Number: P51114; FXR1. Expression Region: 123-199aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 9.8kda. Target Synonyms: FMR1 autosomal homolog 1; hFXR1p Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Fragile X mental retardation syndrome-related protein 1 (FXR1), partial is a purified Recombinant Protein.

Accession Number

P51114; FXR1

Expression Region

123-199aa

Host

E. coli

Target

Fragile X mental retardation syndrome-related protein 1 (FXR1)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

9.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

FMR1 autosomal homolog 1; hFXR1p

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

KNTFFKCTVDVPEDLREACANENAHKDFKKAVGACRIFYHPETTQLMILSASEATVKRVNILSDMHLRSIRTKLMLM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Influenza B (Type B Virus, Flu B) (Biotin)
227026-Biotin 100 µL

Influenza B (Type B Virus, Flu B) (Biotin)

Sign In for Pricing
View Details
EGFR (F4) Alexa Fluor® 594
sc-53274 AF594 200 µg/mL

EGFR (F4) Alexa Fluor® 594

Sign In for Pricing
View Details
hsa-miR-649 miRNA Agomir
MBS8311120-01 5 nmol

hsa-miR-649 miRNA Agomir

Sign In for Pricing
View Details
hsa-miR-649 miRNA Agomir
MBS8311120-02 10 nmol

hsa-miR-649 miRNA Agomir

Sign In for Pricing
View Details
hsa-miR-649 miRNA Agomir
MBS8311120-03 20 nmol

hsa-miR-649 miRNA Agomir

Sign In for Pricing
View Details
hsa-miR-649 miRNA Agomir
MBS8311120-04 5x 20 nmol

hsa-miR-649 miRNA Agomir

Sign In for Pricing
View Details