Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Apolipoprotein A-II (APOA2)

Recombinant Human Apolipoprotein A-II (APOA2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Apolipoprotein A-II (APOA2) . Accession Number: P02652; APOA2. Expression Region: 24-100aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 21.7kda. Target Synonyms: Apo-AII; ApoA-II; Apolipoprotein A2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Apolipoprotein A-II (APOA2) is a purified Recombinant Protein.

Accession Number

P02652; APOA2

Expression Region

24-100aa

Host

E. coli

Target

Apolipoprotein A-II (APOA2)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

21.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Apo-AII; ApoA-II; Apolipoprotein A2

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

QAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CFD ELISA Kit (Human)
OKEH02689-96W 96 Well

CFD ELISA Kit (Human)

Sign In for Pricing
View Details
CF052 rabbit pAb Antibody
orb2305833-01 50 µL

CF052 rabbit pAb Antibody

Sign In for Pricing
View Details
CF052 rabbit pAb Antibody
orb2305833-02 100 µL

CF052 rabbit pAb Antibody

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O6:K15:H31 (strain 536/UPEC) GLPE Polyclonal Antibody
MBS7187781 Inquire

Rabbit anti-Escherichia coli O6:K15:H31 (strain 536/UPEC) GLPE Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse UPF0696 protein C11orf68 homolog (Bles03)
MBS1311258-01 0.02 mg (E-Coli)

Recombinant Mouse UPF0696 protein C11orf68 homolog (Bles03)

Sign In for Pricing
View Details
Recombinant Mouse UPF0696 protein C11orf68 homolog (Bles03)
MBS1311258-02 0.1 mg (E-Coli)

Recombinant Mouse UPF0696 protein C11orf68 homolog (Bles03)

Sign In for Pricing
View Details