Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Apolipoprotein A-II (APOA2)

Recombinant Human Apolipoprotein A-II (APOA2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Apolipoprotein A-II (APOA2) . Accession Number: P02652; APOA2. Expression Region: 24-100aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 21.7kda. Target Synonyms: Apo-AII; ApoA-II; Apolipoprotein A2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Apolipoprotein A-II (APOA2) is a purified Recombinant Protein.

Accession Number

P02652; APOA2

Expression Region

24-100aa

Host

E. coli

Target

Apolipoprotein A-II (APOA2)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

21.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Apo-AII; ApoA-II; Apolipoprotein A2

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

QAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNNM4, CT (CNNM4, ACDP4, KIAA1592, Metal transporter CNNM4, Ancient conserved domain-containing protein 4, Cyclin-M4) (MaxLight 750) discontinued
034047-ML750 100 µL

CNNM4, CT (CNNM4, ACDP4, KIAA1592, Metal transporter CNNM4, Ancient conserved domain-containing protein 4, Cyclin-M4) (MaxLight 750) discontinued

Sign In for Pricing
View Details
6-{[ (9H-Fluoren-9-yl) methoxy]carbonyl}-4H,5H,6H,7H-thieno[2,3-c]pyridine-2-carboxylic acid
UND36853-01 50 mg

6-{[ (9H-Fluoren-9-yl) methoxy]carbonyl}-4H,5H,6H,7H-thieno[2,3-c]pyridine-2-carboxylic acid

Sign In for Pricing
View Details
6-{[ (9H-Fluoren-9-yl) methoxy]carbonyl}-4H,5H,6H,7H-thieno[2,3-c]pyridine-2-carboxylic acid
UND36853-02 0.5 g

6-{[ (9H-Fluoren-9-yl) methoxy]carbonyl}-4H,5H,6H,7H-thieno[2,3-c]pyridine-2-carboxylic acid

Sign In for Pricing
View Details
Recombinant Human CD296/ART1 Protein, C-His
orb2834260-01 20 µg

Recombinant Human CD296/ART1 Protein, C-His

Sign In for Pricing
View Details
Recombinant Human CD296/ART1 Protein, C-His
orb2834260-02 50 µg

Recombinant Human CD296/ART1 Protein, C-His

Sign In for Pricing
View Details
Recombinant Human CD296/ART1 Protein, C-His
orb2834260-03 100 µg

Recombinant Human CD296/ART1 Protein, C-His

Sign In for Pricing
View Details