Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable ATP-dependent RNA helicase DDX60 (DDX60), partial

Recombinant Human Probable ATP-dependent RNA helicase DDX60 (DDX60), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Probable ATP-dependent RNA helicase DDX60 (DDX60) . Accession Number: Q8IY21; DDX60. Expression Region: 772-939aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 23.1kda. Target Synonyms: DEAD box protein 60 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Probable ATP-dependent RNA helicase DDX60 (DDX60), partial is a purified Recombinant Protein.

Accession Number

Q8IY21; DDX60

Expression Region

772-939aa

Host

E. coli

Target

Probable ATP-dependent RNA helicase DDX60 (DDX60)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

DEAD box protein 60

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

LDVVDKNESAVIVAPTSSGKTYASYYCMEKVLKESDDGVVVYVAPTKALVNQVAATVQNRFTKNLPSGEVLCGVFTREYRHDALNCQVLITVPACFEILLLAPHRQNWVKKIRYVIFDEVHCLGGEIGAEIWEHLLVMIRCPFLALSATISNPEHLTEWLQSVKWYWK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF488A conjugate, 0.1mg/mL
BNC880257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF568 conjugate, 0.1mg/mL
BNC680851-100 1x 100 µL

HSP60 (LK1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
BNC880026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (HMPV), CF640R conjugate, 0.1mg/mL
BNC400954-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (HMPV), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1b (RIV12), CF647 conjugate, 0.1mg/mL
BNC470317-100 1x 100 µL

CD1b (RIV12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), CF405S conjugate, 0.1mg/mL
BNC041786-100 1x 100 µL

P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details