Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Keratinocyte differentiation-associated protein (Krtdap)

Recombinant Rat Keratinocyte differentiation-associated protein (Krtdap) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Keratinocyte differentiation-associated protein (Krtdap) . Accession Number: P85411; Krtdap. Expression Region: 23-98aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 21.5kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rat Keratinocyte differentiation-associated protein (Krtdap) is a purified Recombinant Protein.

Accession Number

P85411; Krtdap

Expression Region

23-98aa

Host

E. coli

Target

Keratinocyte differentiation-associated protein (Krtdap)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

21.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

AALGTPMEDTTSSNYPSGTEGLSEFLNFNKLQSAFKSDDFLNWHVLTDMFKKALPFINWEFFPKVKGLRSAVPDSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD62P/P-selectin Rabbit pAb
E45R20796N 50 ul

CD62P/P-selectin Rabbit pAb

Sign In for Pricing
View Details
Human ATG5 Recombinant Protein
PPT-10724 100 µg

Human ATG5 Recombinant Protein

Sign In for Pricing
View Details
ASS1 AAV Vector (Mouse) (CMV)
12570104 1 µg

ASS1 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
DCPS (DCS1, HINT5, m7GpppX Diphosphatase, DCS-1, Hint-related 7meGMP-directed Hydrolase, Histidine Triad Protein Member 5, Scavenger mRNA-decapping Enzyme DcpS, HSPC015) (MaxLight 750)
MBS6232439-01 0.1 mL

DCPS (DCS1, HINT5, m7GpppX Diphosphatase, DCS-1, Hint-related 7meGMP-directed Hydrolase, Histidine Triad Protein Member 5, Scavenger mRNA-decapping Enzyme DcpS, HSPC015) (MaxLight 750)

Sign In for Pricing
View Details
DCPS (DCS1, HINT5, m7GpppX Diphosphatase, DCS-1, Hint-related 7meGMP-directed Hydrolase, Histidine Triad Protein Member 5, Scavenger mRNA-decapping Enzyme DcpS, HSPC015) (MaxLight 750)
MBS6232439-02 5x 0.1 mL

DCPS (DCS1, HINT5, m7GpppX Diphosphatase, DCS-1, Hint-related 7meGMP-directed Hydrolase, Histidine Triad Protein Member 5, Scavenger mRNA-decapping Enzyme DcpS, HSPC015) (MaxLight 750)

Sign In for Pricing
View Details
RAP2B Polyclonal Antibody, Biotin Conjugated
bs-2330R-Biotin 100 µL

RAP2B Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details