Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Butyrophilin subfamily 3 member A1 (BTN3A1), partial

Recombinant Human Butyrophilin subfamily 3 member A1 (BTN3A1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Butyrophilin subfamily 3 member A1 (BTN3A1) . Accession Number: O00481; BTN3A1. Expression Region: 30-254aa. Tag Info: N-terminal 10xHis-tagged. Theoretical MW: 30.2kda. Target Synonyms: CD antigen CD277 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Butyrophilin subfamily 3 member A1 (BTN3A1), partial is a purified Recombinant Protein.

Accession Number

O00481; BTN3A1

Expression Region

30-254aa

Host

E. coli

Target

Butyrophilin subfamily 3 member A1 (BTN3A1)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

30.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CD antigen CD277

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At4g17280 Polyclonal Antibody
MBS7186285 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At4g17280 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Microtubule-Associated Protein 1 Light Chain 3 Alpha (MAP1LC3A) ELISA Kit
QY-E21682 96 Tests

Mouse Microtubule-Associated Protein 1 Light Chain 3 Alpha (MAP1LC3A) ELISA Kit

Sign In for Pricing
View Details
Purified Mouse anti-Horse SAA (Clone 4F6) - Monoclonal
MBS560968-01 1 mg

Purified Mouse anti-Horse SAA (Clone 4F6) - Monoclonal

Sign In for Pricing
View Details
Purified Mouse anti-Horse SAA (Clone 4F6) - Monoclonal
MBS560968-02 5x 1 mg

Purified Mouse anti-Horse SAA (Clone 4F6) - Monoclonal

Sign In for Pricing
View Details
Spaca7 3'UTR Lenti-reporter-Luc Vector
45176084 1.0 µg

Spaca7 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Sodium 4- ((E) - ((1SR,4SR) -7,7-dimethyl-3-oxo-4- (sulfomethyl) bicyclo[2.2.1]heptan-2-ylidene) methyl) -benzaldehyde
466225-01 5 mg

Sodium 4- ((E) - ((1SR,4SR) -7,7-dimethyl-3-oxo-4- (sulfomethyl) bicyclo[2.2.1]heptan-2-ylidene) methyl) -benzaldehyde

Sign In for Pricing
View Details