Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Decorin (DCN)

Recombinant Bovine Decorin (DCN) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bovine (Bos taurus) . Target Name: Decorin (DCN) . Accession Number: P21793; DCN. Expression Region: 31-360aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 40.5kda. Target Synonyms: Bone proteoglycan II; PG-S2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Bovine Decorin (DCN) is a purified Recombinant Protein.

Accession Number

P21793; DCN

Expression Region

31-360aa

Host

E. coli

Target

Decorin (DCN)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

40.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Bone proteoglycan II; PG-S2

Species

Bovine (Bos taurus)

Protein Name

Recombinant Protein

AA Sequence

DEASGIGPEEHFPEVPEIEPMGPVCPFRCQCHLRVVQCSDLGLEKVPKDLPPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLSKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITTIPQGLPPSLTELHLDGNKITKVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYLHNNNISAIGSNDFCPPGYNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRAAVQLGNYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Prl shRNA (UAS) - Lentiviral mouse Prl shRNA (UAS, iRFP) plasmid
GTR15187660 1 Vial

Lentiviral mouse Prl shRNA (UAS) - Lentiviral mouse Prl shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Mouse Monoclonal HPV16 L1 Antibody (CamVir 1) [Janelia Fluor 646]
NB100-2732JF646 0.1 mL

Mouse Monoclonal HPV16 L1 Antibody (CamVir 1) [Janelia Fluor 646]

Sign In for Pricing
View Details
Brucella Broth
DHBRB-0500 500 g

Brucella Broth

Sign In for Pricing
View Details
C1orf64 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-15073R-BF647 100 µL

C1orf64 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
TNFRSF19 (Tumor Necrosis Factor Receptor Superfamily, Member 19, TAJ, TAJ-alpha, TRADE, TROY) (MaxLight 750) discontinued
252826-ML750 100 µL

TNFRSF19 (Tumor Necrosis Factor Receptor Superfamily, Member 19, TAJ, TAJ-alpha, TRADE, TROY) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Rabbit anti-AKT Antibody
MBS4512141-01 0.05 mL

Rabbit anti-AKT Antibody

Sign In for Pricing
View Details