Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Somatotropin (GH1)

Recombinant Macaca mulatta Somatotropin (GH1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Macaca mulatta (Rhesus macaque) . Target Name: Somatotropin (GH1) . Accession Number: P33093; Gh1. Expression Region: 27-217aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 29.7kda. Target Synonyms: Growth hormone; GH; GH-N; Growth hormone 1; Pituitary growth hormone Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Macaca mulatta Somatotropin (GH1) is a purified Recombinant Protein.

Accession Number

P33093; Gh1

Expression Region

27-217aa

Host

E. coli

Target

Somatotropin (GH1)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Developmental Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

29.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Growth hormone; GH; GH-N; Growth hormone 1; Pituitary growth hormone

Species

Macaca mulatta (Rhesus macaque)

Protein Name

Recombinant Protein

AA Sequence

FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGTSYSDVYDLLKDLEEGIQTLMGRLEDGSSRTGQIFKQTYSKFDTNSHNNDALLKNYGLLYCFRKDMDKIETFLRIVQCRSVEGSCGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LTBR Polyclonal Antibody, Cy5 Conjugated
bs-6917R-Cy5 100 µL

LTBR Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
ABCG2 (ATP-binding Cassette Sub-family G Member 2, Placenta-specific ATP-binding Cassette Transporter, Breast Cancer Resistance Protein, Mitoxantrone Resistance-associated Protein, CD338 Antigen, CDw338, ABCP, BCRP, BCRP1, MXR) (MaxLight 550) discontinued
137513-ML550 100 µL

ABCG2 (ATP-binding Cassette Sub-family G Member 2, Placenta-specific ATP-binding Cassette Transporter, Breast Cancer Resistance Protein, Mitoxantrone Resistance-associated Protein, CD338 Antigen, CDw338, ABCP, BCRP, BCRP1, MXR) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Rab11fip4 (NM_175543) Mouse Recombinant Protein
TP516420 20 µg

Rab11fip4 (NM_175543) Mouse Recombinant Protein

Sign In for Pricing
View Details
Krt6a sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3656402 1.0 µg DNA

Krt6a sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Anti-CBLN2 Rabbit pAb
GB111673 100 μL

Anti-CBLN2 Rabbit pAb

Sign In for Pricing
View Details
Human Siglec-2/CD22 MAb (Clone 219902)
MAB19681 100 µg

Human Siglec-2/CD22 MAb (Clone 219902)

Sign In for Pricing
View Details