Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Somatotropin (GH1)

Recombinant Macaca mulatta Somatotropin (GH1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Macaca mulatta (Rhesus macaque) . Target Name: Somatotropin (GH1) . Accession Number: P33093; Gh1. Expression Region: 27-217aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 29.7kda. Target Synonyms: Growth hormone; GH; GH-N; Growth hormone 1; Pituitary growth hormone Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Macaca mulatta Somatotropin (GH1) is a purified Recombinant Protein.

Accession Number

P33093; Gh1

Expression Region

27-217aa

Host

E. coli

Target

Somatotropin (GH1)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Developmental Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

29.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Growth hormone; GH; GH-N; Growth hormone 1; Pituitary growth hormone

Species

Macaca mulatta (Rhesus macaque)

Protein Name

Recombinant Protein

AA Sequence

FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGTSYSDVYDLLKDLEEGIQTLMGRLEDGSSRTGQIFKQTYSKFDTNSHNNDALLKNYGLLYCFRKDMDKIETFLRIVQCRSVEGSCGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKIB Protein Vector (Rat) (pPM-C-HA)
PV294256 500 ng

PKIB Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
SMPD2 Peptide - N-terminal region
MBS3232712-01 0.1 mg

SMPD2 Peptide - N-terminal region

Sign In for Pricing
View Details
SMPD2 Peptide - N-terminal region
MBS3232712-02 5x 0.1 mg

SMPD2 Peptide - N-terminal region

Sign In for Pricing
View Details
ZNF146 Rabbit Polyclonal Antibody
TA351976 100 µL

ZNF146 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TPPP Antibody
E38QA3522 100 µL

TPPP Antibody

Sign In for Pricing
View Details
KLHL36 Protein Vector (Human) (pPM-C-HA)
PV022943 500 ng

KLHL36 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details