Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G2/mitotic-specific cyclin-B1 (CCNB1)

Recombinant Human G2/mitotic-specific cyclin-B1 (CCNB1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: G2/mitotic-specific cyclin-B1 (CCNB1) . Accession Number: P14635; CCNB1. Expression Region: 1-433aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 52.4kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human G2/mitotic-specific cyclin-B1 (CCNB1) is a purified Recombinant Protein.

Accession Number

P14635; CCNB1

Expression Region

1-433aa

Host

E. coli

Target

G2/mitotic-specific cyclin-B1 (CCNB1)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

52.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Salmonella paratyphi A Glucans biosynthesis protein D (mdoD), partial
MBS1293745 Inquire

Recombinant Salmonella paratyphi A Glucans biosynthesis protein D (mdoD), partial

Sign In for Pricing
View Details
RAMP3 siRNA (Rat)
CRR1538-01 15 nmol

RAMP3 siRNA (Rat)

Sign In for Pricing
View Details
RAMP3 siRNA (Rat)
CRR1538-02 30 nmol

RAMP3 siRNA (Rat)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Matrix Metalloproteinase 14 (MMP14)
MBS2094119-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Matrix Metalloproteinase 14 (MMP14)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Matrix Metalloproteinase 14 (MMP14)
MBS2094119-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Matrix Metalloproteinase 14 (MMP14)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Matrix Metalloproteinase 14 (MMP14)
MBS2094119-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Matrix Metalloproteinase 14 (MMP14)

Sign In for Pricing
View Details