Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Interleukin-13 (IL13)

Recombinant Dog Interleukin-13 (IL13) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Dog (Canis familiaris; Canine) . Target Name: Interleukin-13 (IL13) . Accession Number: Q9N0W9; IL13. Expression Region: 19-131aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 16.5kda. Target Synonyms: IL-13 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Dog Interleukin-13 (IL13) is a purified Recombinant Protein.

Accession Number

Q9N0W9; IL13

Expression Region

19-131aa

Host

E. coli

Target

Interleukin-13 (IL13)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

16.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

IL-13

Species

Dog (Canis familiaris; Canine)

Protein Name

Recombinant Protein

AA Sequence

SPSPVTPSPTLKELIEELVNITQNQASLCNGSMVWSVNLTAGMYCAALESLINVSDCSAIQRTQRMLKALCSQKPAAGQISSERSRDTKIEVIQLVKNLLTYVRGVYRHGNFR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Membrane Protein Human YWHAH-AS1 (YWHAH antisense RNA 1) Expressed in vitro E.coli expression system, Full Length
MPX1223K Each

Magic™ Membrane Protein Human YWHAH-AS1 (YWHAH antisense RNA 1) Expressed in vitro E.coli expression system, Full Length

Sign In for Pricing
View Details
Krt40 Mouse shRNA Lentiviral Particle (Locus ID 406221)
TL508761V 500 µL Each

Krt40 Mouse shRNA Lentiviral Particle (Locus ID 406221)

Sign In for Pricing
View Details
Lentiviral human FPR2 shRNA (UAS) - Lentiviral human FPR2 shRNA (UAS, GFP) (25)
GTR15155648 1 Vial

Lentiviral human FPR2 shRNA (UAS) - Lentiviral human FPR2 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Telazorlimab (Anti-TNFRSF4 / OX40 / CD134)
A2326-1mg*5 5x 1mg

Telazorlimab (Anti-TNFRSF4 / OX40 / CD134)

Sign In for Pricing
View Details
MRPL10 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
30437156 3x 1.0 µg DNA

MRPL10 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
NT5M sgRNA CRISPR Lentivector (Human) (Target 1)
K1460402 1.0 µg DNA

NT5M sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details