Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Clusterin (CLU)

Recombinant Human Clusterin (CLU) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Clusterin (CLU) . Accession Number: P10909; CLU. Expression Region: 23-449aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 52.3kda. Target Synonyms: Aging-associated gene 4 protein; Apolipoprotein J; Apo-J; Complement cytolysis inhibitor; CLI; Complement-associated protein SP-40,40; Ku70-binding protein 1; NA1/NA2; Sulfated glycoprotein 2; SGP-2; Testosterone-repressed prostate message 2; TRPM-2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Clusterin (CLU) is a purified Recombinant Protein.

Accession Number

P10909; CLU

Expression Region

23-449aa

Host

Mammalian Cells

Target

Clusterin (CLU)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Apoptosis

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

52.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Aging-associated gene 4 protein; Apolipoprotein J; Apo-J; Complement cytolysis inhibitor; CLI; Complement-associated protein SP-40,40; Ku70-binding protein 1; NA1/NA2; Sulfated glycoprotein 2; SGP-2; Testosterone-repressed prostate message 2; TRPM-2

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Tripartite motif-containing protein 6, TRIM6 ELISA KIT
ELI-28927h 96 Tests

Human Tripartite motif-containing protein 6, TRIM6 ELISA KIT

Sign In for Pricing
View Details
Recombinant Salmonella typhi Sulfurtransferase TusE (tusE)
MBS1396362-01 0.02 mg (E-Coli)

Recombinant Salmonella typhi Sulfurtransferase TusE (tusE)

Sign In for Pricing
View Details
Recombinant Salmonella typhi Sulfurtransferase TusE (tusE)
MBS1396362-02 0.1 mg (E-Coli)

Recombinant Salmonella typhi Sulfurtransferase TusE (tusE)

Sign In for Pricing
View Details
Recombinant Salmonella typhi Sulfurtransferase TusE (tusE)
MBS1396362-03 0.02 mg (Yeast)

Recombinant Salmonella typhi Sulfurtransferase TusE (tusE)

Sign In for Pricing
View Details
Recombinant Salmonella typhi Sulfurtransferase TusE (tusE)
MBS1396362-04 0.1 mg (Yeast)

Recombinant Salmonella typhi Sulfurtransferase TusE (tusE)

Sign In for Pricing
View Details
Recombinant Salmonella typhi Sulfurtransferase TusE (tusE)
MBS1396362-05 0.02 mg (Baculovirus)

Recombinant Salmonella typhi Sulfurtransferase TusE (tusE)

Sign In for Pricing
View Details