Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Clusterin (CLU)

Recombinant Human Clusterin (CLU) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Clusterin (CLU) . Accession Number: P10909; CLU. Expression Region: 23-449aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 52.3kda. Target Synonyms: Aging-associated gene 4 protein; Apolipoprotein J; Apo-J; Complement cytolysis inhibitor; CLI; Complement-associated protein SP-40,40; Ku70-binding protein 1; NA1/NA2; Sulfated glycoprotein 2; SGP-2; Testosterone-repressed prostate message 2; TRPM-2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Clusterin (CLU) is a purified Recombinant Protein.

Accession Number

P10909; CLU

Expression Region

23-449aa

Host

Mammalian Cells

Target

Clusterin (CLU)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Apoptosis

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

52.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Aging-associated gene 4 protein; Apolipoprotein J; Apo-J; Complement cytolysis inhibitor; CLI; Complement-associated protein SP-40,40; Ku70-binding protein 1; NA1/NA2; Sulfated glycoprotein 2; SGP-2; Testosterone-repressed prostate message 2; TRPM-2

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H mgB4 Antibody
E92744 100 µg

H mgB4 Antibody

Sign In for Pricing
View Details
RGS9 Antibody
CSB-PA019662ESR1HU-01 50 μL

RGS9 Antibody

Sign In for Pricing
View Details
RGS9 Antibody
CSB-PA019662ESR1HU-02 100 µL

RGS9 Antibody

Sign In for Pricing
View Details
Lentiviral mouse Zc3hav1l shRNA (UAS) - Lentiviral mouse Zc3hav1l shRNA (UAS) (100)
GTR15124794 1 Vial

Lentiviral mouse Zc3hav1l shRNA (UAS) - Lentiviral mouse Zc3hav1l shRNA (UAS) (100)

Sign In for Pricing
View Details
RPL12P23 AAV siRNA Pooled Vector
40775161 1.0 µg

RPL12P23 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
EMC9 Polyclonal Antibody, Biotin Conjugated
A57260-100 100 µL

EMC9 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details