Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cyclin-dependent kinase 7 (CDK7)

Recombinant Human Cyclin-dependent kinase 7 (CDK7) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Cyclin-dependent kinase 7 (CDK7) . Accession Number: P50613; CDK7. Expression Region: 1-346aa. Tag Info: N-terminal 10xHis-tagged. Theoretical MW: 41.5kda. Target Synonyms: 39 kDa protein kinase; p39 Mo15; CDK-activating kinase 1; Cell division protein kinase 7; Serine/threonine-protein kinase 1; TFIIH basal transcription factor complex kinase subunit Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Cyclin-dependent kinase 7 (CDK7) is a purified Recombinant Protein.

Accession Number

P50613; CDK7

Expression Region

1-346aa

Host

Baculovirus

Target

Cyclin-dependent kinase 7 (CDK7)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

41.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

39 kDa protein kinase; p39 Mo15; CDK-activating kinase 1; Cell division protein kinase 7; Serine/threonine-protein kinase 1; TFIIH basal transcription factor complex kinase subunit

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM92 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2395006 1.0 µg DNA

TMEM92 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
IN80B, ID (INO80B, HMGA1L4, PAPA1, ZNHIT4, INO80 complex subunit B, High mobility group AT-hook 1-like 4, IES2 homolog, PAP-1-associated protein 1, Zinc finger HIT domain-containing protein 4) (AP) discontinued
037040-AP 200 µL

IN80B, ID (INO80B, HMGA1L4, PAPA1, ZNHIT4, INO80 complex subunit B, High mobility group AT-hook 1-like 4, IES2 homolog, PAP-1-associated protein 1, Zinc finger HIT domain-containing protein 4) (AP) discontinued

Sign In for Pricing
View Details
ASPH (Aspartyl/Asparaginyl beta-hydroxylase, Aspartate beta-hydroxylase, ASP beta-hydroxylase, Peptide-aspartate beta-dioxygenase) (FITC)
123638-FITC 100 µL

ASPH (Aspartyl/Asparaginyl beta-hydroxylase, Aspartate beta-hydroxylase, ASP beta-hydroxylase, Peptide-aspartate beta-dioxygenase) (FITC)

Sign In for Pricing
View Details
Lentiviral mouse Gm5134 shRNA (UAS) - Lentiviral mouse Gm5134 shRNA (UAS, GFP) (100)
GTR15206265 1 Vial

Lentiviral mouse Gm5134 shRNA (UAS) - Lentiviral mouse Gm5134 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
3-Demethyl Thiocolchicine-d3
008007 5 mg

3-Demethyl Thiocolchicine-d3

Sign In for Pricing
View Details
C17 Blocking Peptide
CBP4384-01 1 mg

C17 Blocking Peptide

Sign In for Pricing
View Details