Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cyclin-dependent kinase 7 (CDK7)

Recombinant Human Cyclin-dependent kinase 7 (CDK7) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Cyclin-dependent kinase 7 (CDK7) . Accession Number: P50613; CDK7. Expression Region: 1-346aa. Tag Info: N-terminal 10xHis-tagged. Theoretical MW: 41.5kda. Target Synonyms: 39 kDa protein kinase; p39 Mo15; CDK-activating kinase 1; Cell division protein kinase 7; Serine/threonine-protein kinase 1; TFIIH basal transcription factor complex kinase subunit Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Cyclin-dependent kinase 7 (CDK7) is a purified Recombinant Protein.

Accession Number

P50613; CDK7

Expression Region

1-346aa

Host

Baculovirus

Target

Cyclin-dependent kinase 7 (CDK7)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

41.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

39 kDa protein kinase; p39 Mo15; CDK-activating kinase 1; Cell division protein kinase 7; Serine/threonine-protein kinase 1; TFIIH basal transcription factor complex kinase subunit

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human VPS37C qPCR Primer Pair
QH43917S 200 Tests

Human VPS37C qPCR Primer Pair

Sign In for Pricing
View Details
Hsa-miR-550a-5p miRNA Antagomir
CIJ0625-01 10 nmol

Hsa-miR-550a-5p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-550a-5p miRNA Antagomir
CIJ0625-02 20 nmol

Hsa-miR-550a-5p miRNA Antagomir

Sign In for Pricing
View Details
IMPDH2 Conjugated Antibody
orb1624542 100 µL

IMPDH2 Conjugated Antibody

Sign In for Pricing
View Details
L-Lysinamide (dihydrochloride)
HY-W097268 100 mg

L-Lysinamide (dihydrochloride)

Sign In for Pricing
View Details
Nsg1 (NM_024128) Rat Tagged ORF Clone Lentiviral Particle
RR202908L3V 200 µL

Nsg1 (NM_024128) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details