Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3)

Recombinant Human EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3) . Accession Number: O43854; EDIL3. Expression Region: 24-480aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 57.0kda. Target Synonyms: Developmentally-regulated endothelial cell locus 1 protein; Integrin-binding protein DEL1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3) is a purified Recombinant Protein.

Accession Number

O43854; EDIL3

Expression Region

24-480aa

Host

Baculovirus

Target

EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

57.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Developmentally-regulated endothelial cell locus 1 protein; Integrin-binding protein DEL1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

DICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nori Rabbit S100A11 ELISA Kit
GR144291 96 Well

Nori Rabbit S100A11 ELISA Kit

Sign In for Pricing
View Details
Microtubule-Associated Protein Tau Phospho-Ser356 (MAPT pS356) Antibody
abx333129 100 µL

Microtubule-Associated Protein Tau Phospho-Ser356 (MAPT pS356) Antibody

Sign In for Pricing
View Details
GIRK1 (KCNJ3) Human Gene Knockout Kit (CRISPR)
KN205322BN 1 Kit

GIRK1 (KCNJ3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Secretory Leukocyte Peptidase Inhibitor (SLPI) Protein
abx069004-01 10 µg

Mouse Secretory Leukocyte Peptidase Inhibitor (SLPI) Protein

Sign In for Pricing
View Details
Mouse Secretory Leukocyte Peptidase Inhibitor (SLPI) Protein
abx069004-02 50 µg

Mouse Secretory Leukocyte Peptidase Inhibitor (SLPI) Protein

Sign In for Pricing
View Details
Mouse Secretory Leukocyte Peptidase Inhibitor (SLPI) Protein
abx069004-03 100 µg

Mouse Secretory Leukocyte Peptidase Inhibitor (SLPI) Protein

Sign In for Pricing
View Details