Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3)

Recombinant Human EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3) . Accession Number: O43854; EDIL3. Expression Region: 24-480aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 57.0kda. Target Synonyms: Developmentally-regulated endothelial cell locus 1 protein; Integrin-binding protein DEL1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3) is a purified Recombinant Protein.

Accession Number

O43854; EDIL3

Expression Region

24-480aa

Host

Baculovirus

Target

EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

57.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Developmentally-regulated endothelial cell locus 1 protein; Integrin-binding protein DEL1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

DICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC16A9 (NM_194298) Human Untagged Clone
SC313779 10 µg

SLC16A9 (NM_194298) Human Untagged Clone

Sign In for Pricing
View Details
Human ABHD16B Pre-designed siRNA Set A
SI000088A 1 Each

Human ABHD16B Pre-designed siRNA Set A

Sign In for Pricing
View Details
TOR1AIP2 Adenovirus (Mouse)
47316054 1.0 mL

TOR1AIP2 Adenovirus (Mouse)

Sign In for Pricing
View Details
H2A.Z (H2AFZ) (NM_002106) Human Tagged Lenti ORF Clone
RC210691L2 10 µg

H2A.Z (H2AFZ) (NM_002106) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rat PDPN (Podoplanin) ELISA Kit
ELK6233-01 48 Tests

Rat PDPN (Podoplanin) ELISA Kit

Sign In for Pricing
View Details
Rat PDPN (Podoplanin) ELISA Kit
ELK6233-02 96 Tests

Rat PDPN (Podoplanin) ELISA Kit

Sign In for Pricing
View Details