Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3)

Recombinant Human EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3) . Accession Number: O43854; EDIL3. Expression Region: 24-480aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 57.0kda. Target Synonyms: Developmentally-regulated endothelial cell locus 1 protein; Integrin-binding protein DEL1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3) is a purified Recombinant Protein.

Accession Number

O43854; EDIL3

Expression Region

24-480aa

Host

Baculovirus

Target

EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

57.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Developmentally-regulated endothelial cell locus 1 protein; Integrin-binding protein DEL1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

DICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

anti-CDK2 (2E8)
LF-MA10052 100 ug

anti-CDK2 (2E8)

Sign In for Pricing
View Details
Ebola Virus (Ebolavirus, EHF, EV, EVD, EBOV, Ebola Hemorrhagic Fever, Ebola Virus Zaire)
E1007 250 µg

Ebola Virus (Ebolavirus, EHF, EV, EVD, EBOV, Ebola Hemorrhagic Fever, Ebola Virus Zaire)

Sign In for Pricing
View Details
LCP1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1203706 1.0 µg DNA

LCP1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Nup88 (NM_172394) Mouse Tagged Lenti ORF Clone
MR217578L3 10 µg

Nup88 (NM_172394) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit anti-Drosophila melanogaster (Fruit fly) GR22E Polyclonal Antibody
MBS7160983 Inquire

Rabbit anti-Drosophila melanogaster (Fruit fly) GR22E Polyclonal Antibody

Sign In for Pricing
View Details
RNF7 Peptide
DF13992-BP 1 mg

RNF7 Peptide

Sign In for Pricing
View Details