Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3)

Recombinant Human EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3) . Accession Number: O43854; EDIL3. Expression Region: 24-480aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 57.0kda. Target Synonyms: Developmentally-regulated endothelial cell locus 1 protein; Integrin-binding protein DEL1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3) is a purified Recombinant Protein.

Accession Number

O43854; EDIL3

Expression Region

24-480aa

Host

Baculovirus

Target

EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

57.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Developmentally-regulated endothelial cell locus 1 protein; Integrin-binding protein DEL1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

DICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ARL15 ELISA Kit
E000977 1 Each

Human ARL15 ELISA Kit

Sign In for Pricing
View Details
CKS1B Human Pre-designed siRNA Set A
HY-RS02742 1 Set

CKS1B Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rbp4 (NM_001159487) Mouse Tagged Lenti ORF Clone
MR202066L3 10 µg

Rbp4 (NM_001159487) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
IGFBP2 (G-4) : m-IgG Fc BP-HRP Bundle
sc-531295 1 Kit

IGFBP2 (G-4) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
NR4A2/NURR1 Rabbit anti-Human Polyclonal (C-Terminus) Antibody
MBS2402201-01 0.05 mL

NR4A2/NURR1 Rabbit anti-Human Polyclonal (C-Terminus) Antibody

Sign In for Pricing
View Details
NR4A2/NURR1 Rabbit anti-Human Polyclonal (C-Terminus) Antibody
MBS2402201-02 5x 0.05 mL

NR4A2/NURR1 Rabbit anti-Human Polyclonal (C-Terminus) Antibody

Sign In for Pricing
View Details