Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Autographa californica nuclear polyhedrosis virus Major capsid protein (P39)

Recombinant Autographa californica nuclear polyhedrosis virus Major capsid protein (P39) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Autographa californica nuclear polyhedrosis virus (AcMNPV) . Target Name: Major capsid protein (P39) . Accession Number: P17499; P39. Expression Region: 1-347aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 46.4kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Autographa californica nuclear polyhedrosis virus Major capsid protein (P39) is a purified Recombinant Protein.

Accession Number

P17499; P39

Expression Region

1-347aa

Host

E. coli

Target

Major capsid protein (P39)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Microbiology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

46.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Autographa californica nuclear polyhedrosis virus (AcMNPV)

Protein Name

Recombinant Protein

AA Sequence

MALVPVGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAYHDDGWFICNNHLIKRFKMSKMVLPIFDEDDNQFKMTIARHLVGNKERGIKRILIPSATNYQDVFNLNSMMQAEQLIFHLIYNNENAVNTICDNLKYTEGFTSNTQRVIHSVYATTKSILDTTNPNTFCSRVSRDELRFFDVTNARALRGGAGDQLFNNYSGFLQNLIRRAVAPEYLQIDTEELRFRNCATCIIDETGLVASVPDGPELYNPIRSSDIMRSQPNRLQIRNVLKFEGDTRELDRTLSGYEEYPTYVPLFLGYQIINSENNFLRNDFIPRANPNATLGGGAVAGPAPGVAGEAGGGIAV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENO2 Monoclonal Antibody
A10074-50UG 50 µg

ENO2 Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal TMED1 Antibody (1009527) [Allophycocyanin]
FAB2243A 0.1 mL

Mouse Monoclonal TMED1 Antibody (1009527) [Allophycocyanin]

Sign In for Pricing
View Details
STK39 Recombinant Antibody, RBITC Conjugated
bsm-62328R-RBITC 100 µL

STK39 Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
STOML2 antibody
70R-10371 50 ug

STOML2 antibody

Sign In for Pricing
View Details
Rat Transforming Growth Factor Alpha (TGFA) CLIA Kit
abx197820-01 96 Tests

Rat Transforming Growth Factor Alpha (TGFA) CLIA Kit

Sign In for Pricing
View Details
Rat Transforming Growth Factor Alpha (TGFA) CLIA Kit
abx197820-02 5x 96 Tests

Rat Transforming Growth Factor Alpha (TGFA) CLIA Kit

Sign In for Pricing
View Details