Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Autographa californica nuclear polyhedrosis virus Major capsid protein (P39)

Recombinant Autographa californica nuclear polyhedrosis virus Major capsid protein (P39) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Autographa californica nuclear polyhedrosis virus (AcMNPV) . Target Name: Major capsid protein (P39) . Accession Number: P17499; P39. Expression Region: 1-347aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 46.4kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Autographa californica nuclear polyhedrosis virus Major capsid protein (P39) is a purified Recombinant Protein.

Accession Number

P17499; P39

Expression Region

1-347aa

Host

E. coli

Target

Major capsid protein (P39)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Microbiology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

46.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Autographa californica nuclear polyhedrosis virus (AcMNPV)

Protein Name

Recombinant Protein

AA Sequence

MALVPVGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAYHDDGWFICNNHLIKRFKMSKMVLPIFDEDDNQFKMTIARHLVGNKERGIKRILIPSATNYQDVFNLNSMMQAEQLIFHLIYNNENAVNTICDNLKYTEGFTSNTQRVIHSVYATTKSILDTTNPNTFCSRVSRDELRFFDVTNARALRGGAGDQLFNNYSGFLQNLIRRAVAPEYLQIDTEELRFRNCATCIIDETGLVASVPDGPELYNPIRSSDIMRSQPNRLQIRNVLKFEGDTRELDRTLSGYEEYPTYVPLFLGYQIINSENNFLRNDFIPRANPNATLGGGAVAGPAPGVAGEAGGGIAV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Helicobacter pylori urease B
E57V1350 50 µg

Helicobacter pylori urease B

Sign In for Pricing
View Details
HeraSafe 2030i Class 2 A2 Biological Safety Cabinet 1.2m with Factory Acceptance Test Documentation Binder
CAB2750 1 Each

HeraSafe 2030i Class 2 A2 Biological Safety Cabinet 1.2m with Factory Acceptance Test Documentation Binder

Sign In for Pricing
View Details
ATF3 (Activating Transcription Factor 3) (MaxLight 405)
MBS6407471-01 0.1 mL

ATF3 (Activating Transcription Factor 3) (MaxLight 405)

Sign In for Pricing
View Details
ATF3 (Activating Transcription Factor 3) (MaxLight 405)
MBS6407471-02 5x 0.1 mL

ATF3 (Activating Transcription Factor 3) (MaxLight 405)

Sign In for Pricing
View Details
Tprkb (BC027162) Mouse Tagged ORF Clone Lentiviral Particle
MR201518L4V 200 µL

Tprkb (BC027162) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human Interferon Lambda-1 (IFNL1) ELISA Kit
abx251271-01 96 Tests

Human Interferon Lambda-1 (IFNL1) ELISA Kit

Sign In for Pricing
View Details