Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coagulation factor XIII B chain (F13B), partial

Recombinant Human Coagulation factor XIII B chain (F13B), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Coagulation factor XIII B chain (F13B) . Accession Number: P05160; F13B. Expression Region: 260-403aa. Tag Info: N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged. Theoretical MW: 51.5kda. Target Synonyms: Fibrin-stabilizing factor B subunit; Protein-glutamine gamma-glutamyltransferase B chain; Transglutaminase B chain Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Coagulation factor XIII B chain (F13B), partial is a purified Recombinant Protein.

Accession Number

P05160; F13B

Expression Region

260-403aa

Host

E. coli

Target

Coagulation factor XIII B chain (F13B)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-GST-Tagged and C-Terminal Myc-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

51.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Fibrin-stabilizing factor B subunit; Protein-glutamine gamma-glutamyltransferase B chain; Transglutaminase B chain

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

WYPESPVCEGRRNRCPPPPLPINSKIQTHSTTYRHGEIVHIECELNFEIHGSAEIRCEDGKWTEPPKCIEGQEKVACEEPPFIENGAANLHSKIYYNGDKVTYACKSGYLLHGSNEITCNRGKWTLPPECVENNENCKHPPVVM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Thymus Specific Serine Protease (TSSP)
MBS2123748-01 0.01 mg

Recombinant Thymus Specific Serine Protease (TSSP)

Sign In for Pricing
View Details
Recombinant Thymus Specific Serine Protease (TSSP)
MBS2123748-02 0.05 mg

Recombinant Thymus Specific Serine Protease (TSSP)

Sign In for Pricing
View Details
Recombinant Thymus Specific Serine Protease (TSSP)
MBS2123748-03 0.1 mg

Recombinant Thymus Specific Serine Protease (TSSP)

Sign In for Pricing
View Details
Recombinant Thymus Specific Serine Protease (TSSP)
MBS2123748-04 0.2 mg

Recombinant Thymus Specific Serine Protease (TSSP)

Sign In for Pricing
View Details
Recombinant Thymus Specific Serine Protease (TSSP)
MBS2123748-05 0.5 mg

Recombinant Thymus Specific Serine Protease (TSSP)

Sign In for Pricing
View Details
Recombinant Thymus Specific Serine Protease (TSSP)
MBS2123748-06 1 mg

Recombinant Thymus Specific Serine Protease (TSSP)

Sign In for Pricing
View Details