Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cyclin-dependent kinase 7 (CDK7)

Recombinant Human Cyclin-dependent kinase 7 (CDK7) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Cyclin-dependent kinase 7 (CDK7) . Accession Number: P50613; CDK7. Expression Region: 1-346aa. Tag Info: Tag-Free. Theoretical MW: 39.2kda. Target Synonyms: 39 kDa protein kinase; p39 Mo15; CDK-activating kinase 1; Cell division protein kinase 7; Serine/threonine-protein kinase 1; TFIIH basal transcription factor complex kinase subunit Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Cyclin-dependent kinase 7 (CDK7) is a purified Recombinant Protein.

Accession Number

P50613; CDK7

Expression Region

1-346aa

Host

E. coli

Target

Cyclin-dependent kinase 7 (CDK7)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

39.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

39 kDa protein kinase; p39 Mo15; CDK-activating kinase 1; Cell division protein kinase 7; Serine/threonine-protein kinase 1; TFIIH basal transcription factor complex kinase subunit

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gamma Tubulin Rabbit Monoclonal Antibody
E10G22373 100 µL

Gamma Tubulin Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ADH6, ID (ADH6, Alcohol dehydrogenase 6) (MaxLight 650) discontinued
031639-ML650 100 µL

ADH6, ID (ADH6, Alcohol dehydrogenase 6) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Coatomer subunit delta (ARCN1) (NM_001655) Human Recombinant Protein
E45H37104M5 20 µg

Coatomer subunit delta (ARCN1) (NM_001655) Human Recombinant Protein

Sign In for Pricing
View Details
GPR101 Rabbit Polyclonal Antibody (BF488)
orb2538634 100 µL

GPR101 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Plastic Rod Dry Swabs, Synthetic Toe Nut, Sterile Single Blister 100 Swabs
ACC4912 100 Swabs

Plastic Rod Dry Swabs, Synthetic Toe Nut, Sterile Single Blister 100 Swabs

Sign In for Pricing
View Details
Syzalterin
orb1708437 5 mg

Syzalterin

Sign In for Pricing
View Details