Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cyclin-dependent kinase 7 (CDK7)

Recombinant Human Cyclin-dependent kinase 7 (CDK7) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Cyclin-dependent kinase 7 (CDK7) . Accession Number: P50613; CDK7. Expression Region: 1-346aa. Tag Info: Tag-Free. Theoretical MW: 39.2kda. Target Synonyms: 39 kDa protein kinase; p39 Mo15; CDK-activating kinase 1; Cell division protein kinase 7; Serine/threonine-protein kinase 1; TFIIH basal transcription factor complex kinase subunit Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Cyclin-dependent kinase 7 (CDK7) is a purified Recombinant Protein.

Accession Number

P50613; CDK7

Expression Region

1-346aa

Host

E. coli

Target

Cyclin-dependent kinase 7 (CDK7)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

39.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

39 kDa protein kinase; p39 Mo15; CDK-activating kinase 1; Cell division protein kinase 7; Serine/threonine-protein kinase 1; TFIIH basal transcription factor complex kinase subunit

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Aminopeptidase P1/XPNPEP1 Antibody (SAIC-07B-14) [DyLight 488]
NBP3-20090G 0.1 mL

Rabbit Monoclonal Aminopeptidase P1/XPNPEP1 Antibody (SAIC-07B-14) [DyLight 488]

Sign In for Pricing
View Details
PARP3 Rabbit Polyclonal Antibody
E53P11829 100 µL

PARP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
POGK Antibody - N-terminal region : FITC (ARP39287_P050-FITC)
ARP39287_P050-FITC 100 µL

POGK Antibody - N-terminal region : FITC (ARP39287_P050-FITC)

Sign In for Pricing
View Details
Anti-Human Interleukin-15 receptor subunit alpha / IL15RA / CD215
IT-300-156M2-01 0.1 mg

Anti-Human Interleukin-15 receptor subunit alpha / IL15RA / CD215

Sign In for Pricing
View Details
Anti-Human Interleukin-15 receptor subunit alpha / IL15RA / CD215
IT-300-156M2-02 0.5 mg

Anti-Human Interleukin-15 receptor subunit alpha / IL15RA / CD215

Sign In for Pricing
View Details
TLR2 (Toll-like Receptor 2, CD282, TIL4) (PE)
252719-PE 100 µL

TLR2 (Toll-like Receptor 2, CD282, TIL4) (PE)

Sign In for Pricing
View Details