Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cystatin-A (CSTA)

Recombinant Human Cystatin-A (CSTA) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Cystatin-A (CSTA) . Accession Number: P01040; CSTA. Expression Region: 2-98aa. Tag Info: N-terminal GST-tagged. Theoretical MW: 38.3kda. Target Synonyms: Cystatin-AS; Stefin-A Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Cystatin-A (CSTA) is a purified Recombinant Protein.

Accession Number

P01040; CSTA

Expression Region

2-98aa

Host

E. coli

Target

Cystatin-A (CSTA)

Conjugation

Unconjugated

Tag

N-Terminal GST-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

38.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cystatin-AS; Stefin-A

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

IPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

THRB1 Rabbit Polyclonal Antibody (BF594)
orb1587021 100 µL

THRB1 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Trp73 3'UTR Luciferase Stable Cell Line
TU121175 1.0 mL

Trp73 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Magnetospirillum magneticum Ribulose bisphosphate carboxylase (cbbM)
MBS1380845-01 0.02 mg (E-Coli)

Recombinant Magnetospirillum magneticum Ribulose bisphosphate carboxylase (cbbM)

Sign In for Pricing
View Details
Recombinant Magnetospirillum magneticum Ribulose bisphosphate carboxylase (cbbM)
MBS1380845-02 0.02 mg (Yeast)

Recombinant Magnetospirillum magneticum Ribulose bisphosphate carboxylase (cbbM)

Sign In for Pricing
View Details
Recombinant Magnetospirillum magneticum Ribulose bisphosphate carboxylase (cbbM)
MBS1380845-03 0.1 mg (E-Coli)

Recombinant Magnetospirillum magneticum Ribulose bisphosphate carboxylase (cbbM)

Sign In for Pricing
View Details
Recombinant Magnetospirillum magneticum Ribulose bisphosphate carboxylase (cbbM)
MBS1380845-04 0.1 mg (Yeast)

Recombinant Magnetospirillum magneticum Ribulose bisphosphate carboxylase (cbbM)

Sign In for Pricing
View Details