Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neurogenic locus notch homolog protein 1 (NOTCH1), partial

Recombinant Human Neurogenic locus notch homolog protein 1 (NOTCH1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Neurogenic locus notch homolog protein 1 (NOTCH1) . Accession Number: P46531; NOTCH1. Expression Region: 2428-2555aa. Tag Info: N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged. Theoretical MW: 48.7kda. Target Synonyms: Notch 1; hN1; Translocation-associated notch protein TAN-1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Neurogenic locus notch homolog protein 1 (NOTCH1), partial is a purified Recombinant Protein.

Accession Number

P46531; NOTCH1

Expression Region

2428-2555aa

Host

E. coli

Target

Neurogenic locus notch homolog protein 1 (NOTCH1)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-GST-Tagged and C-Terminal Myc-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

48.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Notch 1; hN1; Translocation-associated notch protein TAN-1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

HLGRSFLSGEPSQADVQPLGPSSLAVHTILPQESPALPTSLPSSLVPPVTAAQFLTPPSQHSYSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNVSDWSEGVSSPPTSMQSQIARIPEAFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL
BNC680253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL
BNC740633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF640R conjugate, 0.1mg/mL
BNC401052-500 1x 500 µL

CD3e (B-B12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF405S conjugate, 0.1mg/mL
BNC040333-500 1x 500 µL

CD8 (RIV11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL
BNC400178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL
BNC740026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details