Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neurogenic locus notch homolog protein 1 (NOTCH1), partial

Recombinant Human Neurogenic locus notch homolog protein 1 (NOTCH1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Neurogenic locus notch homolog protein 1 (NOTCH1) . Accession Number: P46531; NOTCH1. Expression Region: 2428-2555aa. Tag Info: N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged. Theoretical MW: 48.7kda. Target Synonyms: Notch 1; hN1; Translocation-associated notch protein TAN-1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Neurogenic locus notch homolog protein 1 (NOTCH1), partial is a purified Recombinant Protein.

Accession Number

P46531; NOTCH1

Expression Region

2428-2555aa

Host

E. coli

Target

Neurogenic locus notch homolog protein 1 (NOTCH1)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-GST-Tagged and C-Terminal Myc-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

48.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Notch 1; hN1; Translocation-associated notch protein TAN-1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

HLGRSFLSGEPSQADVQPLGPSSLAVHTILPQESPALPTSLPSSLVPPVTAAQFLTPPSQHSYSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNVSDWSEGVSSPPTSMQSQIARIPEAFK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-Linked Polyclonal Antibody to Geminin (GMNN)
MBS2094597-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Geminin (GMNN)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Geminin (GMNN)
MBS2094597-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Geminin (GMNN)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Geminin (GMNN)
MBS2094597-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Geminin (GMNN)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Geminin (GMNN)
MBS2094597-04 1 mL

Biotin-Linked Polyclonal Antibody to Geminin (GMNN)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Geminin (GMNN)
MBS2094597-05 5 mL

Biotin-Linked Polyclonal Antibody to Geminin (GMNN)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Geminin (GMNN)
MBS2094597-06 5x 5 mL

Biotin-Linked Polyclonal Antibody to Geminin (GMNN)

Sign In for Pricing
View Details