Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli Negative regulator of flagellin synthesis (flgM)

Recombinant E. coli Negative regulator of flagellin synthesis (flgM) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12) . Target Name: Negative regulator of flagellin synthesis (flgM) . Accession Number: P0AEM4; flgM. Expression Region: 1-97aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 17.8kda. Target Synonyms: Anti-sigma-28 factor Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant E. coli Negative regulator of flagellin synthesis (flgM) is a purified Recombinant Protein.

Accession Number

P0AEM4; flgM

Expression Region

1-97aa

Host

E. coli

Target

Negative regulator of flagellin synthesis (flgM)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Anti-sigma-28 factor

Species

E. coli (strain K12)

Protein Name

Recombinant Protein

AA Sequence

MSIDRTSPLKPVSTVQPRETTDAPVTNSRAAKTTASTSTSVTLSDAQAKLMQPGSSDINLERVEALKLAIRNGELKMDTGKIADALINEAQQDLQSN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Histone Deacetylase 1 (HDAC1) ELISA Kit
RD-HDAC1-Mu-48Tests 48 Tests

Mouse Histone Deacetylase 1 (HDAC1) ELISA Kit

Sign In for Pricing
View Details
Human PRKACB (NM_182948) AAV Particle
RC219853A1V 250 µL

Human PRKACB (NM_182948) AAV Particle

Sign In for Pricing
View Details
PCDHGC4 Antibody
MBS9400579-01 0.1 mL

PCDHGC4 Antibody

Sign In for Pricing
View Details
PCDHGC4 Antibody
MBS9400579-02 5x 0.1 mL

PCDHGC4 Antibody

Sign In for Pricing
View Details
CSF2 Antibody
A18267-100UL 100 µL

CSF2 Antibody

Sign In for Pricing
View Details
PRDX6 (Peroxiredoxin 6, 1-Cys, AOP2, NSGPx, PRX, aiPLA2, p29, Acidic calcium-independent phospholipase A2, Antioxidant protein 2, Non-selenium glutathione peroxidase, Red blood cells page spot 12)
364741 200 µL

PRDX6 (Peroxiredoxin 6, 1-Cys, AOP2, NSGPx, PRX, aiPLA2, p29, Acidic calcium-independent phospholipase A2, Antioxidant protein 2, Non-selenium glutathione peroxidase, Red blood cells page spot 12)

Sign In for Pricing
View Details