Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli Negative regulator of flagellin synthesis (flgM)

Recombinant E. coli Negative regulator of flagellin synthesis (flgM) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12) . Target Name: Negative regulator of flagellin synthesis (flgM) . Accession Number: P0AEM4; flgM. Expression Region: 1-97aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 17.8kda. Target Synonyms: Anti-sigma-28 factor Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant E. coli Negative regulator of flagellin synthesis (flgM) is a purified Recombinant Protein.

Accession Number

P0AEM4; flgM

Expression Region

1-97aa

Host

E. coli

Target

Negative regulator of flagellin synthesis (flgM)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Anti-sigma-28 factor

Species

E. coli (strain K12)

Protein Name

Recombinant Protein

AA Sequence

MSIDRTSPLKPVSTVQPRETTDAPVTNSRAAKTTASTSTSVTLSDAQAKLMQPGSSDINLERVEALKLAIRNGELKMDTGKIADALINEAQQDLQSN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABT1P1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV757035 1.0 µg DNA

ABT1P1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Laboratory Animal Marker Solution, Blue
G4754 100 mL

Laboratory Animal Marker Solution, Blue

Sign In for Pricing
View Details
Recombinant MUC1 Antibody / Mucin-1
V8642-100UG 100 µg

Recombinant MUC1 Antibody / Mucin-1

Sign In for Pricing
View Details
TRIM68 (NM_018073) Human Recombinant Protein
TP317536 20 µg

TRIM68 (NM_018073) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Monoclonal AHSA1 Antibody (7A6) [Janelia Fluor 646]
NBP2-59393JF646 0.1 mL

Mouse Monoclonal AHSA1 Antibody (7A6) [Janelia Fluor 646]

Sign In for Pricing
View Details
Mouse Rabies Virus Antibody IgG (RV Ab IgG) ELISA Kit
CK-bio-27618-01 48 Tests

Mouse Rabies Virus Antibody IgG (RV Ab IgG) ELISA Kit

Sign In for Pricing
View Details